DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and VhaPPA1-1

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001247111.1 Gene:VhaPPA1-1 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster

Alignment Length:166 Identity:57/167 (34%)
Similarity:89/167 (53%) Gaps:14/167 (8%)


  Fly     5 VSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 69
            ::|.||.   .:..:|...::..|.:|||.|...:||.|....|..|.:..|::|.|:....:||
  Fly    43 LASSNPY---MWACLGIGLSVSLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAI 104

  Fly    70 YGLVVAVLIAGALEEPS-----------KYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVR 123
            |||:.|::::|.||:.|           ..:.:.|::..|||||||...|..|.|:||||.....
  Fly   105 YGLITAIVLSGQLEQFSMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAAL 169

  Fly   124 GTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            ..|....|||.::::.||...:||:||||.||:.:|
  Fly   170 SDAANAALFVKILIVEIFGSAIGLFGLIVGIYMTSK 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 53/157 (34%)
V_ATP_synt_C 15..122 CDD:130170 39/118 (33%)
ATP-synt_C 96..156 CDD:278563 28/60 (47%)
VhaPPA1-1NP_001247111.1 PRK08344 50..204 CDD:236246 53/154 (34%)
ATP-synt_C 54..164 CDD:294318 38/110 (35%)
ATP-synt_C 142..202 CDD:278563 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111128582
eggNOG 1 0.900 E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I774
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10263
RoundUp 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.