DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and atp5mc1

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001005112.1 Gene:atp5mc1 XenbaseID:XB-GENE-5907814 Length:130 Species:Xenopus tropicalis

Alignment Length:129 Identity:35/130 (27%)
Similarity:58/130 (45%) Gaps:27/130 (21%)


  Fly    38 KSGTGIAAMSVMRP-----ELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHL 97
            :||..:.:..|..|     .|..:.::||...||       .:.:....::..:|:        :
 Frog    15 RSGVCLLSRPVSVPLLSYTGLRTEQLMPVPARGI-------QSSVTCRDIDTAAKF--------I 64

  Fly    98 GAGLA-VGFSGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156
            |||.| ||.:|..||  ||.|..:.:.|.|:.|    :||...||....:|.:||:.|:||..:
 Frog    65 GAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 126

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 35/130 (27%)
V_ATP_synt_C 15..122 CDD:130170 22/90 (24%)
ATP-synt_C 96..156 CDD:278563 25/65 (38%)
atp5mc1NP_001005112.1 ATP9 56..130 CDD:164765 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.