DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and VhaPPA1-2

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_650406.2 Gene:VhaPPA1-2 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster

Alignment Length:164 Identity:58/165 (35%)
Similarity:85/165 (52%) Gaps:14/165 (8%)


  Fly     7 SDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYG 71
            :.||.   .:..||...|...|.||||.|....|..:|...|..|.:..|::|.|:....:||||
  Fly    47 TSNPF---LWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYG 108

  Fly    72 LVVAVLIAGALEEPSKY-----------SLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGT 125
            |:.|:|::|.:.:.|..           :::.||...||||.||...:|.|.|:||||.......
  Fly   109 LITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALAD 173

  Fly   126 AQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            |....|||.::::.||...:||:|||||||:.:|
  Fly   174 AANSALFVKILIVEIFGSAIGLFGLIVAIYMTSK 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 55/157 (35%)
V_ATP_synt_C 15..122 CDD:130170 40/118 (34%)
ATP-synt_C 96..156 CDD:278563 28/60 (47%)
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 39/110 (35%)
ATP-synt_C 143..204 CDD:278563 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111128587
eggNOG 1 0.900 E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10263
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.