powered by:
                   
 
    
    
             
          
            Protein Alignment Vha16-1 and VhaPPA1-2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_476801.1 | Gene: | Vha16-1 / 44307 | FlyBaseID: | FBgn0262736 | Length: | 159 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_650406.2 | Gene: | VhaPPA1-2 / 41806 | FlyBaseID: | FBgn0262514 | Length: | 212 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 164 | Identity: | 58/164 - (35%) | 
          
            | Similarity: | 85/164 -  (51%) | Gaps: | 14/164 - (8%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     7 SDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYG 71:.||.   .:..||...|...|.||||.|....|..:|...|..|.:..|::|.|:....:||||
 Fly    47 TSNPF---LWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYG 108
 
 
  Fly    72 LVVAVLIAGALEEPSKY-----------SLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGT 125|:.|:|::|.:.:.|..           :::.||...||||.||...:|.|.|:||||.......
 Fly   109 LITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALAD 173
 
 
  Fly   126 AQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159|....|||.::::.||...:||:|||||||:.:|
 Fly   174 AANSALFVKILIVEIFGSAIGLFGLIVAIYMTSK 207
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45453383 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG0636 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR10263 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 4 | 3.840 |  | 
        
      
           
             Return to query results.
             Submit another query.