DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and atp6v0c

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_988893.1 Gene:atp6v0c XenbaseID:XB-GENE-981790 Length:156 Species:Xenopus tropicalis

Alignment Length:159 Identity:129/160 (81%)
Similarity:141/160 (88%) Gaps:3/160 (2%)


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            ||::.:| .|.|..||.||||:||::|||||||||||||||||||||||||||||||||||||||
 Frog     1 MSTDTAS-APEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 64

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            ||||||||||||||.:|  .|..:||:.|:.|||||:||.|||||||||||||||||||||||||
 Frog    65 IIAIYGLVVAVLIANSL--TSSITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPR 127

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            |||||||||||||||||||||||:.|.||
 Frog   128 LFVGMILILIFAEVLGLYGLIVALILSTK 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 123/146 (84%)
V_ATP_synt_C 15..122 CDD:130170 89/107 (83%)
ATP-synt_C 96..156 CDD:278563 55/60 (92%)
atp6v0cNP_988893.1 V_ATP_synt_C 14..119 CDD:130170 89/107 (83%)
ATP-synt_C 94..153 CDD:306615 55/59 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251470477
eggNOG 1 0.900 E1_COG0636
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 237 1.000 Inparanoid score I3163
OMA 1 1.010
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T600749
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1636
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.