DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and Vha16-2

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_729707.1 Gene:Vha16-2 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster

Alignment Length:159 Identity:109/160 (68%)
Similarity:129/160 (81%) Gaps:2/160 (1%)


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            |.:...::.|.|..|.|..|||.||||:.|||:||||.||.|||.|:|.||::|||:||||||||
  Fly     1 MVTAALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAG 65

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            |||||||||:|||||::.:  .|::...::||||||:||..||.||.||||.|||||||||:|||
  Fly    66 IIAIYGLVVSVLIAGSIGD--DYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPR 128

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            |||||:|||||||||.|||||||||||||
  Fly   129 LFVGMVLILIFAEVLALYGLIVAIYLYTK 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 105/146 (72%)
V_ATP_synt_C 15..122 CDD:130170 71/107 (66%)
ATP-synt_C 96..156 CDD:278563 51/60 (85%)
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 106/147 (72%)
ATP-synt_C 15..120 CDD:294318 71/107 (66%)
ATP-synt_C 94..154 CDD:278563 51/60 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250793226
eggNOG 1 0.900 E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1277
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10263
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.