powered by:
                   
 
    
    
             
          
            Protein Alignment Vha16-1 and Vha16-2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_476801.1 | Gene: | Vha16-1 / 44307 | FlyBaseID: | FBgn0262736 | Length: | 159 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_729707.1 | Gene: | Vha16-2 / 39282 | FlyBaseID: | FBgn0028668 | Length: | 158 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 159 | Identity: | 109/159 - (68%) | 
          
            | Similarity: | 129/159 -  (81%) | Gaps: | 2/159 - (1%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65|.:...::.|.|..|.|..|||.||||:.|||:||||.||.|||.|:|.||::|||:||||||||
 Fly     1 MVTAALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAG 65
 
 
  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130|||||||||:|||||::.:  .|::...::||||||:||..||.||.||||.|||||||||:|||
 Fly    66 IIAIYGLVVSVLIAGSIGD--DYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPR 128
 
 
  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159|||||:|||||||||.|||||||||||||
 Fly   129 LFVGMVLILIFAEVLALYGLIVAIYLYTK 157
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45444258 | 
          
            | Domainoid | 1 | 1.000 | 89 | 1.000 | Domainoid score | I2684 | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG0636 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 1 | 1.050 | 200 | 1.000 | Inparanoid score | I1314 | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 1 | 1.010 | - | - |  | QHG53914 | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1534092at2759 | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0001101 | 
          
            | OrthoInspector | 1 | 1.000 | - | - |  | mtm8409 | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR10263 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X666 | 
          
            |  | 11 | 10.910 |  | 
        
      
           
             Return to query results.
             Submit another query.