DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and atp6v0b

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_955855.2 Gene:atp6v0b / 321724 ZFINID:ZDB-GENE-030131-443 Length:206 Species:Danio rerio


Alignment Length:155 Identity:53/155 - (34%)
Similarity:83/155 - (53%) Gaps:9/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PF-FGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVL 77
            || :..:|...||..|.:|||:|...:|:.|....|..|.:..|:::.::....:||||:::|::
Zfish    47 PFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIV 111

  Fly    78 IAGALEEPS--------KYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            |:...|..|        ..:...|:...||||.||||.|..|..:||||.......||...|||.
Zfish   112 ISNLAENFSGTTPETIGSKNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNANLFVR 176

  Fly   135 MILILIFAEVLGLYGLIVAIYLYTK 159
            ::::.||...:||:|:||||...:|
Zfish   177 ILIVEIFGSAIGLFGVIVAILQTSK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 37/115 (32%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 29/66 (44%)
atp6v0bNP_955855.2 PRK08344 49..200 CDD:236246 50/150 (33%)
ATP-synt_C 51..113 CDD:278563 18/61 (30%)
ATP-synt_C 137..197 CDD:278563 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.