DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and atp6v0b

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_955855.2 Gene:atp6v0b ZFINID:ZDB-GENE-030131-443 Length:206 Species:Danio rerio

Alignment Length:155 Identity:53/156 (34%)
Similarity:83/156 (53%) Gaps:9/156 (6%)


  Fly    14 PF-FGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVL 77
            || :..:|...||..|.:|||:|...:|:.|....|..|.:..|:::.::....:||||:::|::
Zfish    47 PFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIV 111

  Fly    78 IAGALEEPS--------KYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            |:...|..|        ..:...|:...||||.||||.|..|..:||||.......||...|||.
Zfish   112 ISNLAENFSGTTPETIGSKNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNANLFVR 176

  Fly   135 MILILIFAEVLGLYGLIVAIYLYTK 159
            ::::.||...:||:|:||||...:|
Zfish   177 ILIVEIFGSAIGLFGVIVAILQTSK 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 52/154 (34%)
V_ATP_synt_C 15..122 CDD:130170 37/116 (32%)
ATP-synt_C 96..156 CDD:278563 28/60 (47%)
atp6v0bNP_955855.2 PRK08344 49..200 CDD:236246 50/151 (33%)
ATP-synt_C 51..113 CDD:278563 19/62 (31%)
ATP-synt_C 137..197 CDD:278563 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.