DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and Vha16-3

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001189086.1 Gene:Vha16-3 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster

Alignment Length:152 Identity:131/153 (86%)
Similarity:141/153 (92%) Gaps:2/153 (1%)


  Fly     8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 72
            |.|.|..|||.||||||||||||||||||||||||||||:|||||||||||||||||||||||||
  Fly     9 DKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGL 73

  Fly    73 VVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 137
            ||:|||||:|.:  .|::.:|:|||.|||:|||:|||||||||||||||||||||||||||||||
  Fly    74 VVSVLIAGSLSD--SYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 136

  Fly   138 ILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||||||||||
  Fly   137 ILIFAEVLGLYGLIVAIYLYTK 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 127/146 (87%)
V_ATP_synt_C 15..122 CDD:130170 90/107 (84%)
ATP-synt_C 96..156 CDD:278563 57/60 (95%)
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 90/107 (84%)
ATP-synt_C 95..155 CDD:278563 57/60 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250793274
eggNOG 1 0.900 E1_COG0636
Homologene 1 1.000 H68199
Inparanoid 1 1.050 200 1.000 Inparanoid score I1277
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 P PTHR10263
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.