powered by:
Protein Alignment Vha16-1 and Atp5mc1
DIOPT Version :9
Sequence 1: | NP_476801.1 |
Gene: | Vha16-1 / 44307 |
FlyBaseID: | FBgn0262736 |
Length: | 159 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_059007.1 |
Gene: | Atp5mc1 / 29754 |
RGDID: | 61933 |
Length: | 136 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 25/65 - (38%) |
Similarity: | 36/65 - (55%) |
Gaps: | 7/65 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 LGAGLA-VGFSGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156
:|||.| ||.:|..|| ||.|..:.:.|.|:.| :||...||....:|.:||:.|:||..:
Rat 70 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 132
Fly 157 156
Rat 133 132
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0636 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.