DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and vma3

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_594799.1 Gene:vma3 PomBaseID:SPAC1B3.14 Length:161 Species:Schizosaccharomyces pombe

Alignment Length:159 Identity:115/160 (72%)
Similarity:137/160 (86%) Gaps:5/160 (3%)


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            ||:::.   |:|.|||||||..:||:|::.||||||||:|.||:||.|:||:||:|:.|||||||
pombe     1 MSTDLC---PVYAPFFGVMGCTAAIVFASFGAAYGTAKAGVGISAMGVLRPDLIVKNTIPVVMAG 62

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            |||||||||:|||:|.|::  ..|||.|||.|||||:||.:||||||||||||||||||||||||
pombe    63 IIAIYGLVVSVLISGNLKQ--ILSLYSGFIQLGAGLSVGLAGLAAGFAIGIVGDAGVRGTAQQPR 125

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            |||.|||||||||||||||||||:.|.|:
pombe   126 LFVAMILILIFAEVLGLYGLIVALLLNTR 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 111/146 (76%)
V_ATP_synt_C 15..122 CDD:130170 77/107 (72%)
ATP-synt_C 96..156 CDD:278563 53/60 (88%)
vma3NP_594799.1 V_ATP_synt_C 12..117 CDD:130170 77/107 (72%)
PRK09621 13..151 CDD:236595 107/140 (76%)
ATP-synt_C 92..151 CDD:278563 53/59 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 220 1.000 Inparanoid score I890
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T631468
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 LDO PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1636
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.