DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and vma11

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_593600.1 Gene:vma11 PomBaseID:SPAC732.01 Length:162 Species:Schizosaccharomyces pombe

Alignment Length:159 Identity:97/160 (61%)
Similarity:123/160 (77%) Gaps:3/160 (2%)


  Fly     1 MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAG 65
            |||.:.   |||..|||..|..::::||.|||.||||.:|.||||:...|||::|||:|||||:|
pombe     1 MSSNLC---PIYSSFFGFAGVCASMVFSCLGAGYGTALAGRGIAAVGAFRPEIVMKSLIPVVMSG 62

  Fly    66 IIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPR 130
            ||.:||||::|||||.:...:.|||:.|||||.||||||.:|:|||:|||:|||.||:...:|.|
pombe    63 IIGVYGLVMSVLIAGDMSPDNDYSLFSGFIHLSAGLAVGLTGVAAGYAIGVVGDRGVQSFMRQDR 127

  Fly   131 LFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            :||.|:||||||||||||||||.:.|.||
pombe   128 IFVSMVLILIFAEVLGLYGLIVGLILQTK 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 90/146 (62%)
V_ATP_synt_C 15..122 CDD:130170 66/107 (62%)
ATP-synt_C 96..156 CDD:278563 41/60 (68%)
vma11NP_593600.1 ATP-synt_C 12..119 CDD:294318 66/107 (62%)
ATP-synt_C 93..153 CDD:278563 41/60 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.870

Return to query results.
Submit another query.