DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and atp6v0ca

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001098606.2 Gene:atp6v0ca ZFINID:ZDB-GENE-020419-23 Length:154 Species:Danio rerio

Alignment Length:155 Identity:129/156 (83%)
Similarity:140/156 (90%) Gaps:2/156 (1%)


  Fly     5 VSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 69
            :.:.||.|.|||.||||:||::|||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MDTQNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 65

  Fly    70 YGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            ||||||||||..:.:  |.|||:.|:||||||:||.|||||||||||||||||||||||||||||
Zfish    66 YGLVVAVLIANNIGD--KISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 128

  Fly   135 MILILIFAEVLGLYGLIVAIYLYTK 159
            |||||||||||||||||||:.|.||
Zfish   129 MILILIFAEVLGLYGLIVALILSTK 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 125/146 (86%)
V_ATP_synt_C 15..122 CDD:130170 90/107 (84%)
ATP-synt_C 96..156 CDD:278563 56/60 (93%)
atp6v0caNP_001098606.2 V_ATP_synt_C 11..116 CDD:130170 90/107 (84%)
PRK14893 12..154 CDD:184887 124/145 (86%)
ATP-synt_C 90..151 CDD:278563 57/61 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251463180
eggNOG 1 0.900 E1_COG0636
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 244 1.000 Inparanoid score I3213
OMA 1 1.010
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T128653
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1636
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.