DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and vha-2

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_499166.1 Gene:vha-2 WormBaseID:WBGene00006911 Length:161 Species:Caenorhabditis elegans

Alignment Length:154 Identity:108/155 (70%)
Similarity:124/155 (80%) Gaps:1/155 (1%)


  Fly     6 SSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIY 70
            :::...|.||||.||||||.||:.||||||||||..||.:|.||||||||||:|||:|||||.||
 Worm     7 TAERAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIY 71

  Fly    71 GLVVAVLIAGALEEPSK-YSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            |||||:::.|.:...|. |.|.:||.||.|||..|..||.||:||||||||||||||||||||||
 Worm    72 GLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVG 136

  Fly   135 MILILIFAEVLGLYGLIVAIYLYT 158
            |||||||:|||||||:|||:.|.|
 Worm   137 MILILIFSEVLGLYGMIVALILGT 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 107/148 (72%)
V_ATP_synt_C 15..122 CDD:130170 74/108 (69%)
ATP-synt_C 96..156 CDD:278563 49/60 (82%)
vha-2NP_499166.1 V_ATP_synt_C 16..124 CDD:130170 74/108 (69%)
ATP-synt_C 99..158 CDD:306615 48/59 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251496155
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68199
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 LDO PTHR10263
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.