DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and vha-3

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_500188.1 Gene:vha-3 WormBaseID:WBGene00006912 Length:161 Species:Caenorhabditis elegans

Alignment Length:154 Identity:108/155 (70%)
Similarity:124/155 (80%) Gaps:1/155 (1%)


  Fly     6 SSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIY 70
            :::...|.||||.||||||.||:.||||||||||..||.:|.||||||||||:|||:|||||.||
 Worm     7 TAERAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIY 71

  Fly    71 GLVVAVLIAGALEEPSK-YSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVG 134
            |||||:::.|.:...|. |.|.:||.||.|||..|..||.||:||||||||||||||||||||||
 Worm    72 GLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVG 136

  Fly   135 MILILIFAEVLGLYGLIVAIYLYT 158
            |||||||:|||||||:|||:.|.|
 Worm   137 MILILIFSEVLGLYGMIVALILGT 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 107/148 (72%)
V_ATP_synt_C 15..122 CDD:130170 74/108 (69%)
ATP-synt_C 96..156 CDD:278563 49/60 (82%)
vha-3NP_500188.1 V_ATP_synt_C 16..124 CDD:130170 74/108 (69%)
ATP-synt_C 99..158 CDD:306615 48/59 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251496160
eggNOG 1 0.900 E1_COG0636
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 210 1.000 Inparanoid score I2341
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T375052
orthoMCL 1 0.900 OOG5_126803
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1636
TreeFam 1 0.960
1312.700

Return to query results.
Submit another query.