DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and vha-1

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_499165.1 Gene:vha-1 WormBaseID:WBGene00006910 Length:169 Species:Caenorhabditis elegans

Alignment Length:153 Identity:95/154 (62%)
Similarity:122/154 (79%) Gaps:1/154 (1%)


  Fly     5 VSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAI 69
            :.::..:||||||.:|..||:.|:|.|:||||||:|||||:|:|.||:|:||:|||||||||:||
 Worm    14 LKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARPDLVMKAIIPVVMAGIVAI 78

  Fly    70 YGLVVAVLIAGALEEP-SKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFV 133
            |||||||:::|.:|.. :.|::...|.....||..|..||.||:||||.||||||..:||||:||
 Worm    79 YGLVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGAGYAIGIAGDAGVRALSQQPRMFV 143

  Fly   134 GMILILIFAEVLGLYGLIVAIYL 156
            ||||||||||||||||:|||:.|
 Worm   144 GMILILIFAEVLGLYGMIVALIL 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 94/146 (64%)
V_ATP_synt_C 15..122 CDD:130170 64/108 (59%)
ATP-synt_C 96..156 CDD:278563 42/60 (70%)
vha-1NP_499165.1 ATP-synt_C 24..132 CDD:294318 64/108 (59%)
ATP-synt_C 107..166 CDD:278563 42/59 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.