DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and Atp5mc2

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_598240.1 Gene:Atp5mc2 RGDID:620051 Length:141 Species:Rattus norvegicus

Alignment Length:120 Identity:35/121 (29%)
Similarity:57/121 (47%) Gaps:27/121 (22%)


  Fly    42 GIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLA-VGF 105
            |::.::|.||   :.|:||.......|         |:..::..:|:        :|||.| ||.
  Rat    40 GLSCLAVRRP---LTSLIPSRSFQTSA---------ISRDIDTAAKF--------IGAGAATVGV 84

  Fly   106 SGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156
            :|..||  ||.|..:.:.|.|:.|    :||...||....:|.:||:.|:||..:
  Rat    85 AGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 35/121 (29%)
V_ATP_synt_C 15..122 CDD:130170 22/81 (27%)
ATP-synt_C 96..156 CDD:278563 25/65 (38%)
Atp5mc2NP_598240.1 ATP9 67..141 CDD:164765 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.