DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and Atp6v0c

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_570836.1 Gene:Atp6v0c RGDID:621394 Length:155 Species:Rattus norvegicus

Alignment Length:152 Identity:127/153 (83%)
Similarity:138/153 (90%) Gaps:2/153 (1%)


  Fly     8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 72
            :||.|..|||||||:||::|||:||||||||||||||||||||||||||||||||||||||||||
  Rat     6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 70

  Fly    73 VVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 137
            |||||||.:|.:  ..:|||.|:.|||||:||.||||||||||||||||||||||||||||||||
  Rat    71 VVAVLIANSLTD--GITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMIL 133

  Fly   138 ILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||||:.|.||
  Rat   134 ILIFAEVLGLYGLIVALILSTK 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 123/146 (84%)
V_ATP_synt_C 15..122 CDD:130170 89/107 (83%)
ATP-synt_C 96..156 CDD:278563 55/60 (92%)
Atp6v0cNP_570836.1 V_ATP_synt_C 13..118 CDD:130170 89/107 (83%)
ATP-synt_C 93..152 CDD:306615 55/59 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251463411
eggNOG 1 0.900 E1_COG0636
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 238 1.000 Inparanoid score I3231
OMA 1 1.010
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T617775
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 LDO PTHR10263
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.