DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and Atp5mc3

DIOPT Version :10

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001348329.1 Gene:Atp5mc3 / 114630 RGDID:620052 Length:141 Species:Rattus norvegicus


Alignment Length:65 Identity:25/65 - (38%)
Similarity:36/65 - (55%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LGAGLA-VGFSGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156
            :|||.| ||.:|..||  ||.|..:.:.|.|:.|    :||...||....:|.:||:.|:||..:
  Rat    75 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 137

  Fly   157  156
              Rat   138  137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 12/25 (48%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 25/65 (38%)
Atp5mc3NP_001348329.1 ATP9 67..141 CDD:164765 25/65 (38%)

Return to query results.
Submit another query.