DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ome and zgc:136971

Sequence 1:NP_001097606.1 Gene:ome FlyBaseID:FBgn0259175 Length:1040 Species:Drosophila melanogaster
Sequence 2:XP_017212859.1 Gene:zgc:136971 ZFINID:ZDB-GENE-060421-3674 Length:952 Species:Danio rerio

Alignment Length:1114 Identity:196/1115 (18%)
Similarity:366/1115 (33%) Gaps:367/1115 (33%)


  Fly    50 QSCLRQQQRQLQWEQ---QQHQQLQHQLTNSSSEFDEFHWPSKQTGGENLGGKIYITPADIPPPP 111
            :..|:.::|:..:|.   .:....:..:::..||.:   .|::::.||   |.|.:.......|.
Zfish    61 EEALKMRRRKTNFENHLCSKKAACEKMVSHGPSESE---IPNQESTGE---GGIMVEQERTDDPS 119

  Fly   112 QPPHQSGSNSHSHHNGSNRQQQQHQQ------HPHSLHSHIHPHP--------------HPHHQH 156
            |.|               |.::...:      .|...||...|||              ...|..
Zfish   120 QSP---------------RDEEDPPEVNPSVTEPTVSHSAASPHPTEADVAIQTLVNEMFSGHSP 169

  Fly   157 GHRTPPHRCKCEH----PSIELMGYEDSVIATATASNTAANVGVAGGGGVGRHQHPPYYYKAAVG 217
            ...|.|.|.:.:.    |...||.:.         .|...::         |.:||.:.......
Zfish   170 VESTVPQRSRADAQDLCPFCGLMMHR---------KNLQVHL---------RRKHPDHVSNQEKS 216

  Fly   218 RRSSAKL---------HESMLGGGSSLEDDDGTSAGSFGEGMSRFKNLMHTKEKKRRVRIILTVV 273
            .....|:         .:..:...|.:.|              .|::.|         |..:.:.
Zfish   217 APVQMKIPKQQRLPVWQQQKIAMESEIRD--------------VFRHCM---------RFPVPIS 258

  Fly   274 TTVIAVALLATA-----LVFILRTDEKDADDSDSNSNNAIDLEDVLSGQLYAKRFNGSWSNGNSL 333
            .:|||..||.||     :..:.|..:.|.:       ..:.|:           |:.:|    :|
Zfish   259 ASVIADELLDTANKKRCITVLTRWSQCDLE-------RGVKLQ-----------FSKTW----TL 301

  Fly   334 IYKENT---------------SIMEFDAKTGE-RSILLEDAQHYVL-------YEKSADGEFLLL 375
            :.|.:|               .::...:.:|. ::::..:|.|..|       .|||.|...|..
Zfish   302 LCKHDTVEHVLPSGTSSQIENELLSCQSPSGTLQAVIRAEAGHQYLEVWGQNGLEKSLDLTALNK 366

  Fly   376 AKNYKKNFRYSFLA----EYDLYNLNTKEFIQLTIQ------NEQHYLSMVQWSPVGNALVINYD 430
            .....::.::..||    |..|..:..|:.::.::.      ||..          |..|:...|
Zfish   367 HGRVYEDAQFGCLAWSPCEKKLLYVAEKKRVEPSVHSSFGSANEDG----------GLVLLEEQD 421

  Fly   431 RNLYYKE--------SALAQEIALTSDEQAGILNGIPDWVYEEEVFSSNVATWFNPSGTQLAFIK 487
            :|:|.::        |:....:|..:.....|..|:|..:      |...|.| .|:|..:.|: 
Zfish   422 KNVYVEDWGEGLVGKSSPVLCVADLNKATVIIYAGVPPHI------SPAQALW-APNGRGVVFV- 478

  Fly   488 FDDSSTHLINFPYYGDAGDLRYQYPLHQVIAYPKAG---SSNPRVELVMVDLKRAVAGGDFVTV- 548
                  .|.|.|:                    :.|   .||.|..|..:|:|     |:...: 
Zfish   479 ------GLWNEPF--------------------RLGLKFCSNRRSALYYLDMK-----GNCECLS 512

  Fly   549 ---MPVPS-ALNTETDYIVTVVSWV--DDDNVLSIWMNRIQNAAYVVTFDGLNRKV------IYS 601
               |.|.| .::.::.:||.:...|  .....||:.:..::|.:..|..|.:.|..      ||.
Zfish   513 SDGMSVSSPRMSPDSCWIVYLQGEVFGPHHQCLSMMLYDMKNRSSSVLVDVIRRAEKGQFAGIYE 577

  Fly   602 AESKTGWVDLYTAPFRNRNGSRLAFVLPHNNYKHVQLLSSTVASSEPQALEPLTEGKYV----VD 662
            :.....|         :.:..|:.|.....|.|.|..:..|.             ||.:    :|
Zfish   578 SLPSHCW---------SADSERVFFSSACENKKAVFSVDRTT-------------GKIIQVCGLD 620

  Fly   663 SILHWDGKNDIIFYTANTEDHPEQLHLYAIRALAKQSPKCLTCNLIKSGDVQQTYFSATFNDNNH 727
             :|..|....:...|.       |..|..:...:...|.||     ::|      |.:..|....
Zfish   621 -VLRLDDFGSVQLLTI-------QKDLMVLSCSSPNQPPCL-----RAG------FLSKVNRAED 666

  Fly   728 IVITSLGPGIPTTHIYEWKYENSQVVISKVLDWETNESLRAKLKGVALPSHKILTVDIDGGFQAK 792
            :.:::|| |......::|:    .::|:.....|.::........:.|..:.             
Zfish   667 MQLSNLG-GADVYEGFDWQ----PMLITPPSQEENHQFSGLNFGAILLKPYS------------- 713

  Fly   793 VLLQLPPNLDTSGATKYPMLVDVYGGPDSYSVTNKWMVDWGTYLSSNQSVIYA--KIDGRGSGLR 855
                 ||.     ..|.|::|:::|||.::     :..||....::...:.:|  .::.|||...
Zfish   714 -----PPE-----RRKTPLVVNIHGGPHAH-----FAADWNATAAALTKLGFAVLMVNYRGSTGF 763

  Fly   856 GESLLHAIYLKLGTVEISD----QINVTQKLSTLFNYIDPDHVGIWGWSYGGYAAAMALANDEAK 916
            |:..:.::...:|:.::.|    .:...|..:||    |||.|.:.|.|:||:.|...:......
Zfish   764 GQDSIESLLGNVGSQDVKDVQRAVLCALQNETTL----DPDRVVVMGGSHGGFLACHLIGQYPDF 824

  Fly   917 VFKCAA-----------SIAPVTDWAYYDSIYTERYMGLPNTNELGYANSRLSTM---------- 960
            ...|||           ..:.:.||.|             ::..|.||..||.|.          
Zfish   825 YRACAARNPVINAATLLGTSDIVDWRY-------------SSVGLQYAFDRLPTSQSLISMLDKS 876

  Fly   961 ----AVKLRGKKYLLVHGTLDDNVHYQQAMILAKNLERQDILFKQISYADEDHGLSNVRPHLYHS 1021
                |.::|. ..||:.|..|..|...|.:.|.:.|:.::...:.:.::||.|.||.|...    
Zfish   877 PIIHAPQIRA-PVLLMLGGRDRRVSPHQGLELYRALKSRNTPVRLLWFSDEGHTLSKVNTQ---- 936

  Fly  1022 LDRFFGECF 1030
                 .:||
Zfish   937 -----SDCF 940

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omeNP_001097606.1 DPPIV_N 367..739 CDD:279298 75/410 (18%)
Peptidase_S9 828..1033 CDD:278741 51/235 (22%)
FrsA <882..1028 CDD:223999 39/171 (23%)
zgc:136971XP_017212859.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104790290
eggNOG 1 0.900 E1_COG1506
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.