DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ome and Dpp10

Sequence 1:NP_001097606.1 Gene:ome FlyBaseID:FBgn0259175 Length:1040 Species:Drosophila melanogaster
Sequence 2:NP_950186.3 Gene:Dpp10 MGIID:2442409 Length:800 Species:Mus musculus

Alignment Length:794 Identity:237/795 (30%)
Similarity:397/795 (50%) Gaps:69/795 (9%)


  Fly   263 KRRVRIILTVVTTVIAVALLATALVFILRTDEKDADDSDSNSNNAIDLEDVLSGQLYAKRFNGSW 327
            :|..:.|...:..::.|..|.|..|.:|..||     ..::|...:.||::|............|
Mouse    33 QRNWKGIAIALLVILVVCSLITMSVILLTPDE-----LTNSSETRLSLEELLGKGFGLHNPEPRW 92

  Fly   328 SNGNSLIYKENTS-IMEFDAKTGERSILLEDAQHYVLYEK-----SADGEFLLLAKNYKKNFRYS 386
            .|...::||.|.. :|:.:.::...::||:::. :|.::.     |.|.:::|||.:.|:.|.||
Mouse    93 INDTVVVYKTNNGHVMKLNTESNASTLLLDNST-FVTFKASRHSLSPDLKYVLLAYDVKQIFHYS 156

  Fly   387 FLAEYDLYNLNTKEFIQLT-IQNEQHYLSMVQWSPVGNALVINYDRNLYYKESALAQEIALTSDE 450
            |.|.|.:||::|.|..:|. .:.|...|....|...|..|:..::.|:||:....:..:.|||..
Mouse   157 FTASYLIYNIHTGEVWELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQPDIKSSSLRLTSSG 221

  Fly   451 QAGIL-NGIPDWVYEEEVFSSNVATWFNPSGTQLAFIKFDDSSTHLINFPYYGDAGDLRYQYPLH 514
            :.||: |||.||:||||:..|::|.|::|.|.:|||:..:||....:..|.:..|     .||..
Mouse   222 KEGIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLMINDSLVPNMIIPRFTGA-----LYPKA 281

  Fly   515 QVIAYPKAGSSNPRVELVMVDLKRAVAGGDFVTVMPVPSALNTETDYIVTVVSWVDDDNVLSIWM 579
            :...|||||.:||.|:|.:|:|.     |...|:..:|..:....:|.:|:|.||.:...:..|:
Mouse   282 KQYPYPKAGQANPSVKLYVVNLY-----GPTHTLELMPPDIFKSREYYITMVKWVSNTRTVVRWL 341

  Fly   580 NRIQNAAYVV----TFDGLNRKVIYSAESKTGWVDLYT-APFRNRNGSRLAFVLP-----HNNYK 634
            ||.||.:.:.    |....:||  |...|.| |:.... .|..:|:||:....:|     ...:.
Mouse   342 NRPQNISILTLCESTTGACSRK--YEMTSDT-WLSKQNEEPVFSRDGSKFFMTVPVKQGGRGEFH 403

  Fly   635 HVQLLSSTVASSEPQALEPLTEGKYVVDSILHWDGKNDIIFYTANTEDHPEQLHLYAIRALAKQS 699
            |:.:. ...:.||...:..||.|.:.|..||.:|.....|:: .:||..|:...||:.......:
Mouse   404 HIAMF-LVQSKSEQITVRHLTSGNWEVIRILAYDETTQKIYF-LSTESSPQGRQLYSASTEGLLN 466

  Fly   700 PKCLTCNLIKSGDVQQTYFSATFND-NNHIVITSLGPGIP--TTHIYE-----WKYENSQVVISK 756
            ..|::||.:|.   ..|||.|:|:. |.|.::...||.:|  :.||.:     :..||:.|:   
Mouse   467 RDCISCNFMKE---DCTYFDASFSPMNQHFLLFCEGPKVPVVSLHITDNPSRYFLLENNSVM--- 525

  Fly   757 VLDWETNESLRAKLKGVALPSHKILTVDIDGGFQAKVLLQLPPNLDTSGATKYPMLVDVYGGPDS 821
                  .|:::.  |.:|....:||.:|   .::..:.|..|.  |.....:|.:|:.:...|..
Mouse   526 ------KETIQK--KKLAKRETRILHID---DYELPLQLSFPK--DFMEKNQYALLLIMDEEPGG 577

  Fly   822 YSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESLLHAIYLKLGTVEISDQINVTQKLSTLF 886
            ..||:|:.|||.:.|....:||.|:.||||||.:|..:|..|:.::|:||..||:...:.|... 
Mouse   578 QMVTDKFHVDWDSVLIDTDNVIVARFDGRGSGFQGLKVLQEIHRRIGSVEAKDQVAAVKYLLKQ- 641

  Fly   887 NYIDPDHVGIWGWSYGGYAAAMALANDEAKVFKCAASIAPVTDWAYYDSIYTERYMGLPNTNELG 951
            .|||...:.|:|..||||.|:|.|.:|| |.|||.|.:||::|...|.|.::|||:|:|:..|..
Mouse   642 PYIDSKRLSIFGKGYGGYIASMILKSDE-KFFKCGAVVAPISDMKLYASAFSERYLGMPSKEEST 705

  Fly   952 YANSRLSTMAVKLRGKKYLLVHGTLDDNVHYQQAMILAKNLERQDILFKQISYADEDHGLSN-VR 1015
            |..|.:......|:.:..|::|||.|..||:|.:..|.|:|.:..:.:....|.||.:.:|: .:
Mouse   706 YQASSVLHNIHGLKEENLLIIHGTADTKVHFQHSAELIKHLIKAGVNYTLQVYPDEGYHISDKSK 770

  Fly  1016 PHLYHSLDRFFGEC 1029
            .|.|.::.|||.:|
Mouse   771 HHFYSTILRFFSDC 784

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omeNP_001097606.1 DPPIV_N 367..739 CDD:279298 119/387 (31%)
Peptidase_S9 828..1033 CDD:278741 76/204 (37%)
FrsA <882..1028 CDD:223999 54/147 (37%)
Dpp10NP_950186.3 DPPIV_N 137..503 CDD:279298 118/384 (31%)
Peptidase_S9 584..786 CDD:278741 76/204 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1506
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000294
OrthoInspector 1 1.000 T615304
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11731
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1793
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.