DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ome and DPP4

Sequence 1:NP_001097606.1 Gene:ome FlyBaseID:FBgn0259175 Length:1040 Species:Drosophila melanogaster
Sequence 2:NP_001926.2 Gene:DPP4 HGNCID:3009 Length:766 Species:Homo sapiens

Alignment Length:817 Identity:263/818 (32%)
Similarity:411/818 (50%) Gaps:110/818 (13%)


  Fly   267 RIILTVVTTVIAVALLATALVFILRTDEKDADDSDSNSNNAIDLEDVLSGQLYAKRFNGSWSNGN 331
            :::|.::.....|.::...:|.:    .|..||:.::|.....|.|.|......|.::..|.:.:
Human     6 KVLLGLLGAAALVTIITVPVVLL----NKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDH 66

  Fly   332 SLIYKENTSIMEFDAKTGERSILLEDAQ-----HYVL-YEKSADGEFLLLAKNYKKNFRYSFLAE 390
            ..:||:..:|:.|:|:.|..|:.||::.     |.:. |..|.||:|:||..||.|.:|:|:.|.
Human    67 EYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTAS 131

  Fly   391 YDLYNLNTKEFI-QLTIQNEQHYLSMVQWSPVGNALVINYDRNLYYK-ESAL-AQEIALTSDEQA 452
            ||:|:||.::.| :..|.|...:   |.|||||:.|...::.::|.| |..| :..|..|..|..
Human   132 YDIYDLNKRQLITEERIPNNTQW---VTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDI 193

  Fly   453 GILNGIPDWVYEEEVFSSNVATWFNPSGTQLAFIKFDDSSTHLINFPYYGDAGDLRYQYPLHQVI 517
             |.|||.||||||||||:..|.|::|:||.||:.:|:|:...||.:.:|.|..   .|||....:
Human   194 -IYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDES---LQYPKTVRV 254

  Fly   518 AYPKAGSSNPRVELVMV--DLKRAVAGGDFVTVMPVPSALNTETDYIVTVVSWVDDDNVLSIWMN 580
            .|||||:.||.|:..:|  |...:|.....:.:....|.|  ..|:.:..|:|...:.:...|:.
Human   255 PYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASML--IGDHYLCDVTWATQERISLQWLR 317

  Fly   581 RIQNAAYVVTFDGLNRKVIYSAE---------------SKTGWVDLY--TAPFRNRNGSRLAFVL 628
            ||||.:.:...|       |...               |.||||..:  :.|....:|:....::
Human   318 RIQNYSVMDICD-------YDESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKII 375

  Fly   629 PH-NNYKHV--------QLLSSTVASSEPQALEPLTEGKYVVDSILHWDGKNDIIFYTANT-EDH 683
            .: ..|:|:        .....|..:.|...:|.||               :|.::|.:|. :..
Human   376 SNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALT---------------SDYLYYISNEYKGM 425

  Fly   684 PEQLHLYAIRALAKQSPKCLTCNLIKSGDVQQTYFSATFN-DNNHIVITSLGPGIP--TTHIYEW 745
            |...:||.|:........||:|.|   ...:..|:|.:|: :..:..:...|||:|  |.|    
Human   426 PGGRNLYKIQLSDYTKVTCLSCEL---NPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLH---- 483

  Fly   746 KYENSQVVISKVLD-----WETNESLRAKLKGVALPSHKILTVDIDGGFQAKVLLQ--LPPNLDT 803
                     |.|.|     .|.|.:|...|:.|.:||.|:..:.::   :.|...|  |||:.|.
Human   484 ---------SSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILN---ETKFWYQMILPPHFDK 536

  Fly   804 SGATKYPMLVDVYGGPDSYSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESLLHAIYLKLG 868
            |  .|||:|:|||.||.|......:.::|.|||:|.:::|.|..||||||.:|:.::|||..:||
Human   537 S--KKYPLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLG 599

  Fly   869 TVEISDQINVTQKLSTLFNYIDPDHVGIWGWSYGGYAAAMALANDEAKVFKCAASIAPVTDWAYY 933
            |.|:.|||...::.|.: .::|...:.|||||||||..:|.|.:... ||||..::|||:.|.||
Human   600 TFEVEDQIEAARQFSKM-GFVDNKRIAIWGWSYGGYVTSMVLGSGSG-VFKCGIAVAPVSRWEYY 662

  Fly   934 DSIYTERYMGL--PNTNELGYANSRLSTMAVKLRGKKYLLVHGTLDDNVHYQQAMILAKNLERQD 996
            ||:||||||||  |..|...|.||.:.:.|...:..:|||:|||.|||||:||:..::|.|....
Human   663 DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVG 727

  Fly   997 ILFKQISYADEDHGL--SNVRPHLYHSLDRFFGECFA 1031
            :.|:.:.|.|||||:  |....|:|..:..|..:||:
Human   728 VDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFS 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omeNP_001097606.1 DPPIV_N 367..739 CDD:279298 119/407 (29%)
Peptidase_S9 828..1033 CDD:278741 91/209 (44%)
FrsA <882..1028 CDD:223999 65/150 (43%)
DPP4NP_001926.2 DPPIV_N 108..478 CDD:279298 118/404 (29%)
DAP2 <398..764 CDD:224423 144/404 (36%)
Peptidase_S9 559..763 CDD:278741 90/206 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C175594559
eggNOG 1 0.900 E1_COG1506
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000294
OrthoInspector 1 1.000 T608480
orthoMCL 1 0.900 OOG5_128614
Panther 1 1.100 O PTHR11731
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1793
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.