DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ome and apeh

Sequence 1:NP_001097606.1 Gene:ome FlyBaseID:FBgn0259175 Length:1040 Species:Drosophila melanogaster
Sequence 2:NP_942570.3 Gene:apeh ZFINID:ZDB-GENE-030131-9870 Length:746 Species:Danio rerio

Alignment Length:801 Identity:154/802 (19%)
Similarity:265/802 (33%) Gaps:223/802 (28%)


  Fly   316 GQLYAKRFNGSWSNGNSLIYKENTSIMEFDAKTGERSILLEDAQHYVLY--EKSA---------- 368
            |.:....:.|.:||    ||.|.|.      :..||...::..:.|:::  :||.          
Zfish    47 GPVITSGYGGQYSN----IYTEWTQ------RDLERMENVKFCRQYIVFHHDKSVVYSGPSGNCT 101

  Fly   369 --DGEFL-----------LLAKNYKKNFRYSFLAEYDLYNLNTK-EFIQLTIQN------EQHYL 413
              .||.|           :|.:|..:.....||   ::::.|.| :.:.||..|      |....
Zfish   102 EIRGELLSVDSPSGEMKAVLRENTTEGEEKQFL---EIWHKNRKLKCLNLTTLNKHGKVYEDDQF 163

  Fly   414 SMVQWSPVGNALVINYDRNLYYKESALAQ--EIALTSDEQAGILNGIPDWVYEEEVFSSNVATWF 476
            ..:.||.....|:...::.....||...|  |.:||.||:..|...     .:||....:     
Zfish   164 GCLVWSHSETHLLYIAEKKRPKTESYFQQGPETSLTPDEEEPIKTD-----KKEETVPGH----- 218

  Fly   477 NPSGTQLAFIKFDDSSTHLINFPYYGDAGDLRYQYPLHQVIAYPKAGSSNPRVELVMVDLKRAVA 541
                                .|.||.|.|:             .....|:|  .|.::|::    
Zfish   219 --------------------QFEYYEDWGE-------------NLVSKSSP--VLCVLDIE---- 244

  Fly   542 GGDFVTVMPVPSALN------TETDYIVTVVSWVDDDNVLSIWMNRIQNAAYVVTFDGLNRKVIY 600
            |.:...:..:|:|::      ...|..:..|.|         |....:          |..|...
Zfish   245 GSNISVLEGIPAAISPGQAFWAPADTGLLFVGW---------WHEPFR----------LGLKSCG 290

  Fly   601 SAESKTGWVDLYTAPFRNRNGSRLAFVLPHNNYKHVQL--LSSTVASSEPQ-----ALEPLTEGK 658
            :..|...:|||.:......:...::...|..:..|.::  |.|.|:.|..|     ..:..|:..
Zfish   291 NRRSSLFYVDLASGKCDQLSSDSISVCSPRLSPDHCRIVYLESGVSCSHLQCHRLCVFDWYTKQT 355

  Fly   659 YVVDSILHW---DGKNDIIFYTANTEDHPEQLHLYAIRALAKQSPKCLTCN---------LIKSG 711
            .||..::..   ||...|..:            |.:.|..:..|.:.|.|:         ::.:.
Zfish   356 SVVVDVVQRARDDGFTGIYSF------------LLSPRCWSADSERVLFCSAQRSRKELFVVDTS 408

  Fly   712 DVQQTYFSA--------TFNDNNHIVITSLG-------------PGIPTTHIYEW-KYENSQVVI 754
            ..:.|..::        ..|.:..:::.|..             ||..:.....| ..|.||.  
Zfish   409 SREITRLTSQSQEGSWNLLNIHRDLMVVSCSSPNSPPDLRVGFLPGKGSESKISWVTLEESQP-- 471

  Fly   755 SKVLDWET-NESLRAKLKGVALPSHKILTVDIDGGFQAKVLLQLPPNLDTSGATKYPMLVDVYGG 818
            ...:.|:| |.|...:......|.     :|.|.       |.|.|. ||....|.|::|..:||
Zfish   472 QSDISWQTLNFSPPPEQDNTQYPG-----LDFDA-------LLLKPK-DTPADGKLPLIVMPHGG 523

  Fly   819 PDSYSVTNKWMVDWGTYLSSNQSVIYAKIDGRGSGLRGESLLHAIYLKLGTVEISD-QINVTQKL 882
            |.|..| ::|::..........||:.  ::.|||...|:..:.::....||.::.| |..|...|
Zfish   524 PHSVLV-SEWILSTAVLCKMGFSVLL--VNYRGSLGFGQDNVFSLPGNCGTQDVKDVQFAVDSVL 585

  Fly   883 STLFNYIDPDHVGIWGWSYGGYAAAMALANDEAKVFKCAASIAPVT------------DWAYYDS 935
            ..  ...|...|.:.|.|:||:.|. .|.......:|...:..|||            ||...::
Zfish   586 KQ--GGFDEQKVAVIGGSHGGFLAC-HLIGQYPGFYKACVARNPVTNLASMVCCTDIPDWCIVEA 647

  Fly   936 IYTERYMGLPNTNELGYANSRLSTMAVKLRGK-------KYLLVHGTLDDNVHYQQAMILAKNLE 993
                   |.....::....:.|..|.:|...|       ..||:.|..|..|..:|.:...|.|:
Zfish   648 -------GFDYKPDIQLEPAILEQMLIKSPIKHVAKVKTPVLLMLGEGDKRVPNKQGIEYYKALK 705

  Fly   994 RQDILFKQISYADEDHGLSNV 1014
            ...:..:.:.|...:|.||.|
Zfish   706 SLQVPVRVLWYPGNNHSLSKV 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
omeNP_001097606.1 DPPIV_N 367..739 CDD:279298 73/450 (16%)
Peptidase_S9 828..1033 CDD:278741 45/208 (22%)
FrsA <882..1028 CDD:223999 33/153 (22%)
apehNP_942570.3 DAP2 197..728 CDD:224423 121/639 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1506
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.