DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arr and Lrp4

Sequence 1:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_766256.3 Gene:Lrp4 MGIID:2442252 Length:1905 Species:Mus musculus

Alignment Length:1261 Identity:480/1262 (38%)
Similarity:704/1262 (56%) Gaps:74/1262 (6%)


  Fly    89 LLFTTRHDIQVANITRPTGGPQIDVIVRDLAEAMAIDFYYAKNLVCWTDSGREIIECAQTNSSAL 153
            |||..|.||:.....|    .:..:::.:|..|:|:||::.:.||.|:|...:.|..|..|.|.:
Mouse   442 LLFANRIDIRQVLPHR----SEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNV 502

  Fly   154 QPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLDGRYQKVLFWTDLDQPRAV 218
                    :.|:||||:.|.|||:||..||:||||...:|||||.|||.::|||.|..|::|||:
Mouse   503 --------EEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAI 559

  Fly   219 AVVPARKLLIWTDWGEYPKIERASMDGDPLSRMTLVKEHVFWPNGLAVDLKNELIYWTDGKHHFI 283
            |:.|....:.|||||..|:||.:||||.  .|..:...|:||||||.:|.....:||.|.|||.|
Mouse   560 ALHPMEGTIYWTDWGNTPRIEASSMDGS--GRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVI 622

  Fly   284 DVMRLDGSSRRTIVN-NLKYPFSLTFYDDRLYWTDWQRGSLNALDLQTRELKELI-DTPKAPNSV 346
            :...||||.|:.::: .|.:||::|.::|.||||||...|:|:.:..|.:.:|:| :....|..:
Mouse   623 ERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDI 687

  Fly   347 RAWDPSLQPYEDNPCAHNNGNCSHLCLLATNSQGFSCACPTGVKLISANTCANGSQEMMFIVQRT 411
            ....|..||...|.|..|||.|:||||  .:.|.::||||||.:.|:::.||....:.:...:|.
Mouse   688 HTLHPQRQPAGKNRCGDNNGGCTHLCL--PSGQNYTCACPTGFRKINSHACAQSLDKFLLFARRM 750

  Fly   412 QISKISLDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADGTGVTDFVTSEV 476
            .|.:||.|:.|.:...:||..|:.|:|:|:|..::|:||:||.|.||.||..||||....|.:.:
Mouse   751 DIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSL 815

  Fly   477 RHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWSDWNE 541
            ..|.|||:||:...|||||..||||||...||:.|.|||:|:|:.||.|.|.|..|:|:|:||. 
Mouse   816 ESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWG- 879

  Fly   542 RKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGSGRRVVISDN 606
            ..||:|||.:|.|.|.|::|.||.||||:|:|..::.:||.|.....||.|.:|||.|:|:|...
Mouse   880 ASPKIERAGMDASSRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQ 944

  Fly   607 LKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKVTRLREVRGQNACAVR 671
            |.|.|||::....:||||||.:||..|.::||.:|..:.:...:||.:.|...:.......|||.
Mouse   945 LPHPFGLTLYGQRIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRQRPPVTTLCAVE 1009

  Fly   672 NGGCSHLCLN--RPRDYVCRCAIDYELANDKRTCVVPA--AFLLFSRQEHIGRISIEYNEGNHND 732
            |||||||||.  .|..:.|.|.....|..|.:|| .|.  :||:|:|:..:..:|::        
Mouse  1010 NGGCSHLCLRSPNPSGFSCTCPTGINLLRDGKTC-SPGMNSFLIFARRIDVRMVSLD-------- 1065

  Fly   733 ERIP-FKDV--------RDAHALDVSVAERRIYWTDQKSKCIFRAFLNGSYVQRIVDSGLIGPDG 788
              || |.||        ::..|:.|...|.::||:|.....|.||.|:||..:.|:.:||...||
Mouse  1066 --IPYFADVVVPINMTMKNTIAIGVDPLEGKVYWSDSTLHRISRASLDGSQHEDIITTGLQTTDG 1128

  Fly   789 IAVDWLANNIYWSDAEARRIEVARLDGSSRRVLLWKGVEEPRSLVLEPRRGYMYWTE-SPTDSIR 852
            :|||.:...:||:|....||||..||||.|:||:|:.::.||::||....|:||||: .....:.
Mouse  1129 LAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLE 1193

  Fly   853 RAAMDGSDLQTIVAGAN--HAAGLTFDQETRRLYWATQSRPAKIESADWDGKKRQILVGSDMDEP 915
            |:.||||| :|::...|  ...|||.|:.:.:|.|| .:...:||.||.:|..|..|| |.:..|
Mouse  1194 RSGMDGSD-RTVLINNNLGWPNGLTVDKTSSQLLWA-DAHTERIEVADLNGANRHTLV-SPVQHP 1255

  Fly   916 YAVSLYQDYVYWSDWNTGDIERVHKTTGQNRSLVHSGMTYITSLLVFNDKRQTGVNPCKVNNGGC 980
            |.::|...|:||:||.|..|.|..|:||.|..||.|.:..:..:...:..:..|.|.|...||||
Mouse  1256 YGLTLLDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGC 1320

  Fly   981 SHLCLAQPGRRGMTCACPTHYQLAKDGVSCIP-PRNYIIFSQRNCFGRLLPNTTDCPNIPLPVSG 1044
            |||||.:|.  |.:|||||..||..|..:|.| |..|::||.|....|:..:|.|..::.:||.|
Mouse  1321 SHLCLPRPS--GFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVPVPG 1383

  Fly  1045 -KNIRAVDYDPITHHIYWIEGRSHSIKRSLANGTKVSLLANSG-QPFD-LAIDIIGRLLFWTCSQ 1106
             .|:.::|||.:...:|:.:.....|:|:..||:.:..:...| :..| ||:|.:.|.|:||.:.
Mouse  1384 LNNVISLDYDSVHGKVYYTDVFLDVIRRADLNGSNMETVIGHGLKTTDGLAVDWVARNLYWTDTG 1448

  Fly  1107 SNSINVTSFLGESVGVIDTGDSEKPRNIAVHAMKRLLFWTDVGSHQAIIRARVDGNER-VELAYK 1170
            .|:|..:...|....|:.....::||.|||...|..|||||.|....|.||.:||:|| |.:...
Mouse  1449 RNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTD 1513

  Fly  1171 LEGVTALALDQQSDMIYY--AHGKRIDAIDINGKNKKTLVSMHISQVINIAALGGFVYWLDDKT- 1232
            |.....|.||..:..||:  ||..||::.|:|||.::.||| |:|....:.....::||.|.:| 
Mouse  1514 LGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVS-HVSHPFALTQQDRWIYWTDWQTK 1577

  Fly  1233 GVERI-TVNGERRSAELQRLPQITDIRAVWTPDPKVLRNHTCMHSRTKCSHICIASGEGIARTRD 1296
            .::|: ..:|..:...|..:..:.||..| :|..:...| .|..:...|:|:|      .||..|
Mouse  1578 SIQRVDKYSGRNKETVLANVEGLMDIIVV-SPQRQTGTN-ACGVNNGGCTHLC------FARASD 1634

  Fly  1297 -VCSCPKHLMLLEDKENCGAFPACGP 1321
             ||:||..    .|...|...|...|
Mouse  1635 FVCACPDE----PDGHPCSLVPGLVP 1656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531 24/39 (62%)
NHL 168..503 CDD:302697 149/337 (44%)
NHL repeat 172..237 CDD:271320 36/65 (55%)
LY 252..293 CDD:214531 19/41 (46%)
NHL repeat 261..298 CDD:271320 17/37 (46%)
NHL repeat 303..339 CDD:271320 15/37 (41%)
NHL repeat 341..419 CDD:271320 28/78 (36%)
NHL repeat 428..476 CDD:271320 22/48 (46%)
LY 472..511 CDD:214531 20/39 (51%)
NHL repeat 477..503 CDD:271320 16/26 (62%)
Ldl_recept_b 534..573 CDD:278487 21/39 (54%)
LY 558..599 CDD:214531 19/41 (46%)
LY 600..641 CDD:214531 18/41 (44%)
FXa_inhibition 668..703 CDD:291342 18/37 (49%)
LY 739..773 CDD:214531 13/42 (31%)
LY 776..818 CDD:214531 19/42 (45%)
LY 819..860 CDD:214531 17/42 (40%)
FXa_inhibition 973..1010 CDD:291342 20/37 (54%)
LY 1122..1164 CDD:214531 19/42 (45%)
FXa_inhibition 1273..1313 CDD:291342 12/41 (29%)
LDLa 1319..1362 CDD:238060 1/4 (25%)
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
Lrp4NP_766256.3 LDLa 27..66 CDD:238060
Ldl_recept_a 70..105 CDD:278486
LDLa 110..142 CDD:238060
LDLa 148..182 CDD:238060
LDLa 231..265 CDD:238060
LDLa 270..304 CDD:238060
LDLa 311..343 CDD:197566
FXa_inhibition 358..393 CDD:291342
EGF_CA 395..434 CDD:214542
NHL <471..622 CDD:302697 73/161 (45%)
NHL repeat 471..507 CDD:271320 12/44 (27%)
LDL-receptor class B 1 480..522 19/50 (38%)
LY 505..545 CDD:214531 25/40 (63%)
NHL repeat 510..550 CDD:271320 24/40 (60%)
LDL-receptor class B 2 523..565 24/42 (57%)
NHL repeat 555..589 CDD:271320 17/36 (47%)
LDL-receptor class B 3 566..609 21/45 (47%)
LY 590..632 CDD:214531 19/42 (45%)
NHL repeat 598..622 CDD:271320 13/24 (54%)
LDL-receptor class B 4 610..652 17/42 (40%)
LY 633..673 CDD:214531 14/40 (35%)
LDL-receptor class B 5 653..693 13/40 (33%)
FXa_inhibition 702..>729 CDD:291342 16/29 (55%)
LY 766..806 CDD:214531 20/40 (50%)
LDL-receptor class B 6 785..827 21/42 (50%)
LY 808..850 CDD:214531 20/42 (48%)
LDL-receptor class B 7 828..870 24/42 (57%)
LDL-receptor class B 8 871..914 23/44 (52%)
Ldl_recept_b 871..911 CDD:278487 22/41 (54%)
LY 895..937 CDD:214531 19/42 (45%)
LDL-receptor class B 9 915..956 17/41 (41%)
LY 938..979 CDD:214531 18/41 (44%)
LDL-receptor class B 10 957..998 15/41 (37%)
FXa_inhibition 1006..1043 CDD:291342 18/37 (49%)
NHL <1085..1277 CDD:302697 78/195 (40%)
NHL repeat 1085..1123 CDD:271320 14/38 (37%)
LDL-receptor class B 11 1093..1135 17/42 (40%)
NHL repeat 1128..1161 CDD:271320 17/33 (52%)
LDL-receptor class B 12 1136..1178 19/42 (45%)
NHL repeat 1166..1203 CDD:271320 15/38 (39%)
LDL-receptor class B 13 1179..1222 17/44 (39%)
NHL repeat 1212..1244 CDD:271320 12/33 (36%)
LDL-receptor class B 14 1223..1263 15/42 (36%)
NHL repeat 1253..1277 CDD:271320 10/24 (42%)
LDL-receptor class B 15 1264..1306 15/42 (36%)
FXa_inhibition 1313..1348 CDD:291342 20/37 (54%)
LY 1379..1418 CDD:214531 12/39 (31%)
LDL-receptor class B 16 1397..1439 10/42 (24%)
LY 1420..1460 CDD:214531 12/40 (30%)
LDL-receptor class B 17 1440..1482 13/42 (31%)
LDL-receptor class B 18 1483..1526 18/43 (42%)
Ldl_recept_b 1483..1523 CDD:278487 17/40 (43%)
LY 1507..1547 CDD:214531 14/40 (35%)
LDL-receptor class B 19 1527..1568 15/42 (36%)
LY 1549..1589 CDD:214531 11/41 (27%)
LDL-receptor class B 20 1569..1610 11/42 (26%)
FXa_inhibition 1617..1648 CDD:291342 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102647219
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126933
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.