DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: arr and Lrp1

Sequence 1:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster
Sequence 2:NP_032538.2 Gene:Lrp1 MGIID:96828 Length:4545 Species:Mus musculus

Alignment Length:1613 Identity:466/1614 (29%)
Similarity:746/1614 (46%) Gaps:237/1614 (15%)


  Fly    17 CQVIDNNEDVTTKATKCTKSNSGVGWRQMLIGFLLICFGISNSWQYKNVHMPSSSSLIASPPASA 81
            ||:    :....|..||::...     |........|:   ..|    |..|...|..:..|...
Mouse  1222 CQI----QSYCAKHLKCSQKCD-----QNKFSVKCSCY---EGW----VLEPDGESCRSLDPFKP 1270

  Fly    82 FVNTPATLLFTTRHDIQVANITRPTGGPQIDVIVRDLAEAMAIDFYYAKNLVCWTDSGREIIECA 146
            |:      :|:.||:|:..::.:    ....|:|..|...:|:||:.:::.:.|||    ::|..
Mouse  1271 FI------IFSNRHEIRRIDLHK----GDYSVLVPGLRNTIALDFHLSQSALYWTD----VVEDK 1321

  Fly   147 QTNSSALQPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLDGRYQKVLFWTD 211
            ......|........:.||..||..|||||:||....|||.:...::||||.|||..:..|...|
Mouse  1322 IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGD 1386

  Fly   212 LDQPRAVAVVPARKLLIWTDW-GEYPKIERASMDGDPLSRMTLVKE--HVFWPNGLAVDLKNELI 273
            ::.|||:|:.|...:|.|||| ...|:||.|||.|  ..|.|:.:|  ...|||||.||...:.|
Mouse  1387 IEHPRAIALDPRDGILFWTDWDASLPRIEAASMSG--AGRRTIHRETGSGGWPNGLTVDYLEKRI 1449

  Fly   274 YWTDGKHHFIDVMRLDGSSRRTIVNN---LKYPFSLTFYDDRLYWTDWQRGSLNALDLQTRELKE 335
            .|.|.:...|...|.|||....::..   |.:||::|.|...:|||||:..:|...:..|.....
Mouse  1450 LWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVT 1514

  Fly   336 LID-TPKAPNSVRAWDPSLQPYEDNPCAHNNGN--CSHLCLLATNSQGFSCACPTGVKLISANTC 397
            ::. |...|..::.:.||.||...|||..|.|.  ||||||:..| :..|||||..:||...||.
Mouse  1515 VVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYN-RTVSCACPHLMKLHKDNTT 1578

  Fly   398 ANGSQEMMFIVQRTQISKISLDSPDYT-IFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRA 461
            ....::.:...::.:|..:.||:|.|. |....:..:.....:|||..|:.:|||||.|..||||
Mouse  1579 CYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRA 1643

  Fly   462 HADGTGVTDFVTSEVRHPDGLALDWLARNLYWT--DTVTDRIEVCRLDGTARKVLIYEHLEEPRA 524
            ..:||||...|::::.:..|||:||::|||:||  ||...:|.|.||||:.:..:: :.||:|..
Mouse  1644 FINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVV-QGLEQPHG 1707

  Fly   525 IAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKI 589
            :.|.|..|.::|:|.:    .:..|::|||...:|.|...| |.|:|:|.....:||.......|
Mouse  1708 LVVHPLRGKLYWTDGD----NISMANMDGSNHTLLFSGQKG-PVGLAIDFPESKLYWISSGNHTI 1767

  Fly   590 EVANMDGSGRRVVISDNLKHLFG----LSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPD 650
            ...|:|||...|:  |.::...|    |:|:.|.|:|.|.....:...:|..|:..:|:.:....
Mouse  1768 NRCNLDGSELEVI--DTMRSQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGSVVLRNSTTL 1830

  Fly   651 LMGLKV---TRLREVRGQNACAVRNGGCSHLCLNRPRDYV---CRCAIDYELANDKRTCVVPAAF 709
            :|.:||   :...|..|.|.|:|.||.||.|||  |....   |.|...|.|.:.::.|....:|
Mouse  1831 VMHMKVYDESIQLEHEGTNPCSVNNGDCSQLCL--PTSETTRSCMCTAGYSLRSGQQACEGVGSF 1893

  Fly   710 LLFSRQEHIGRISIEYNEGNHNDERIPFKDVRDAHALDVSVAERRIYWTDQKSKCIFRAFLNGSY 774
            ||:|..|.|..|.::.|:  .:|..:|......|..:|.......|||.|.....|.||..:.::
Mouse  1894 LLYSVHEGIRGIPLDPND--KSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTW 1956

  Fly   775 VQRIVDSGLIGPDGIAVDWLANNIYWSDAEARRIEVARLDGSSRRVLLWKGVEEPRSLVLEPRRG 839
            .:.:|.:|:...:||||||:|.||||:|.....||||||:||.|.|::.:|:::||::.:.|.:|
Mouse  1957 REDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKG 2021

  Fly   840 YMYWTE-SPTDSIRRAAMDGSDLQTIV-AGANHAAGLTFDQETRRLYWATQSRPAKIESADWD-G 901
            |::||| .....|.|:.:||::...:| ...:...|::.|.:..:|||. .:|..|||..|.: |
Mouse  2022 YLFWTEWGHYPRIERSRLDGTERVVLVNVSISWPNGISVDYQGGKLYWC-DARMDKIERIDLETG 2085

  Fly   902 KKRQILVGSDMDEPYAVSLYQDYVYWSDWN--TGDIERVHKTTGQNRSLVHSGM-TYITSLLVFN 963
            :.|::::.|:..:.::||:::|::||||..  .|.|:|..|....:...:.:|: ..:..:.|||
Mouse  2086 ENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRGCKDNATDSVPLRTGIGVQLKDIKVFN 2150

  Fly   964 DKRQTGVNPCKVNNGGCSHLCLAQPGRRGMTCACPTHYQLAKDGVSCIPPRNYIIFSQRNCFGRL 1028
            ..||.|.|.|.|.||||..|||.:.|.: ..||| .|..||:||.||.....|:::|:|.....:
Mouse  2151 RDRQKGTNVCAVANGGCQQLCLYRGGGQ-RACAC-AHGMLAEDGASCREYAGYLLYSERTILKSI 2213

  Fly  1029 LPNTTDCPNIPLPVSG-------KNIRAVDYD------PIT-HHIYWIEGRSHSIKRSLANGT-K 1078
              :.:|..|:..||..       ||:.|:.:|      |.| :.|::.:....:|::...:|: :
Mouse  2214 --HLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGR 2276

  Fly  1079 VSLLANSGQPFDLAIDIIGRLLFWTCSQSNSI--------NVTSFLGESVGVIDTGDSEKPRNIA 1135
            .:::.|.|....||.......|:||...:::|        ...:|..|:| :..:|| :.||...
Mouse  2277 TTIVENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETV-ITMSGD-DHPRAFV 2339

  Fly  1136 VHAMKRLLFWTDVGS-HQAIIRARVDGNERVELAYK-LEGVTALALDQQSDMIYYAHG--KRIDA 1196
            :...:.|:|||:... |.:|:||.:.|...:.|..| :.....||:|.:::.:|::..  .:|:.
Mouse  2340 LDECQNLMFWTNWNELHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIER 2404

  Fly  1197 IDINGKNKKTLVSMHISQVINIAALGGFVYWLD-DKTGVERIT--VNGERRSAELQRLPQITDIR 1258
            .:.:|.::..::.........:|..|..::|.| .:..|:|..  |..:.:...:....|...|.
Mouse  2405 CEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQPMGII 2469

  Fly  1259 AVWTPDPKVLRNHTCMHSRTKCSHICI-------------------------------------- 1285
            || ..|........|..:...|..:|:                                      
Mouse  2470 AV-ANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRAVNSSCRAQDEFEC 2533

  Fly  1286 ASGE---------GIARTRD-------VCS---------------CPKHLMLLEDKENCG----A 1315
            |:||         |::..:|       .|:               |..:::.....::||    .
Mouse  2534 ANGECISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVSNMLWCNGVDDCGDGSDE 2598

  Fly  1316 FP----ACGPDHFTC--AAPVSGISDVNK--DCIPA----------------------------- 1343
            .|    |||...|.|  .:.:...|..|:  ||..|                             
Mouse  2599 IPCNKTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNCSTTDCSSYFRLGVKGVLFQPCER 2663

  Fly  1344 -------SWRCDGQKDCPDKSDEVGC-----PTCRADQFSCQSGECIDKSLVCDGTTNCANGHDE 1396
                   ||.|||..||.|.|||..|     |.|..:.|:|.||.||..|..||...:|.||.||
Mouse  2664 TSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCENGEDE 2728

  Fly  1397 ADCCK--RPGEFQCPINKLCISAALLCDGWENCADGADESSDICLQRRMAPAT 1447
            ..|.|  ...:|:|. |..|||...||||.::|.||:||::. |..:...|::
Mouse  2729 THCNKFCSEAQFECQ-NHRCISKQWLCDGSDDCGDGSDEAAH-CEGKTCGPSS 2779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
arrNP_524737.2 LY 162..201 CDD:214531 20/39 (51%)
NHL 168..503 CDD:302697 133/347 (38%)
NHL repeat 172..237 CDD:271320 30/66 (45%)
LY 252..293 CDD:214531 17/43 (40%)
NHL repeat 261..298 CDD:271320 14/37 (38%)
NHL repeat 303..339 CDD:271320 11/37 (30%)
NHL repeat 341..419 CDD:271320 28/80 (35%)
NHL repeat 428..476 CDD:271320 19/48 (40%)
LY 472..511 CDD:214531 19/41 (46%)
NHL repeat 477..503 CDD:271320 13/28 (46%)
Ldl_recept_b 534..573 CDD:278487 12/39 (31%)
LY 558..599 CDD:214531 14/41 (34%)
LY 600..641 CDD:214531 11/45 (24%)
FXa_inhibition 668..703 CDD:291342 14/38 (37%)
LY 739..773 CDD:214531 9/34 (26%)
LY 776..818 CDD:214531 22/42 (52%)
LY 819..860 CDD:214531 14/42 (33%)
FXa_inhibition 973..1010 CDD:291342 19/37 (51%)
LY 1122..1164 CDD:214531 13/43 (30%)
FXa_inhibition 1273..1313 CDD:291342 10/109 (9%)
LDLa 1319..1362 CDD:238060 20/83 (24%)
LDLa 1365..1399 CDD:238060 15/34 (44%)
LDLa 1399..1433 CDD:197566 16/36 (44%)
Lrp1NP_032538.2 LDLa 27..60 CDD:197566
LDLa 72..105 CDD:197566
FXa_inhibition 120..149 CDD:291342
FXa_inhibition 161..189 CDD:291342
LY 276..315 CDD:214531
LDL-receptor class B 1. {ECO:0000255} 293..335
LY 317..359 CDD:214531
LDL-receptor class B 2. {ECO:0000255} 336..379
LY 362..402 CDD:214531
LDL-receptor class B 3. {ECO:0000255} 380..423
FXa_inhibition 487..520 CDD:291342
LY 552..594 CDD:214531
LDL-receptor class B 4. {ECO:0000255} 572..614
LY 595..634 CDD:214531
LDL-receptor class B 5. {ECO:0000255} 615..660
LY 641..690 CDD:214531
LDL-receptor class B 6. {ECO:0000255} 661..711
LY <701..734 CDD:214531
LDL-receptor class B 7. {ECO:0000255} 712..755
FXa_inhibition 808..843 CDD:291342
LDLa 854..886 CDD:197566
LDLa 896..929 CDD:238060
LDLa 936..968 CDD:197566
LDLa 979..1012 CDD:238060
LDLa 1016..1049 CDD:238060
LDLa 1063..1098 CDD:238060
LDLa 1105..1141 CDD:238060
LDLa 1146..1179 CDD:238060
FXa_inhibition 1186..1222 CDD:291342 466/1614 (29%)
LDL-receptor class B 8. {ECO:0000255} 1310..1356 16/50 (32%)
LY 1337..1377 CDD:214531 21/40 (53%)
LDL-receptor class B 9. {ECO:0000255} 1357..1399 17/42 (40%)
LY 1381..1424 CDD:214531 19/45 (42%)
LDL-receptor class B 10. {ECO:0000255} 1400..1446 22/48 (46%)
LY 1425..1469 CDD:214531 17/44 (39%)
LDL-receptor class B 11. {ECO:0000255} 1447..1491 13/44 (30%)
LDL-receptor class B 12. {ECO:0000255} 1492..1532 10/40 (25%)
LY 1614..1650 CDD:214531 17/36 (47%)
LDL-receptor class B 13. {ECO:0000255} 1628..1670 20/42 (48%)
LY 1651..1694 CDD:214531 19/43 (44%)
LDL-receptor class B 14. {ECO:0000255} 1671..1714 18/44 (41%)
LY 1698..1735 CDD:214531 12/42 (29%)
LDL-receptor class B 15. {ECO:0000255} 1715..1754 14/44 (32%)
LY 1735..1776 CDD:214531 14/42 (33%)
LDL-receptor class B 16. {ECO:0000255} 1755..1799 13/46 (28%)
FXa_inhibition 1851..1887 CDD:291342 14/38 (37%)
LY 1917..1957 CDD:214531 10/40 (25%)
LDL-receptor class B 17. {ECO:0000255} 1935..1977 15/42 (36%)
LY 1960..2000 CDD:214531 22/40 (55%)
LDL-receptor class B 18. {ECO:0000255} 1978..2020 19/42 (45%)
LY 2001..2044 CDD:214531 14/43 (33%)
LDL-receptor class B 19. {ECO:0000255} 2021..2064 12/43 (28%)
LY 2046..2088 CDD:214531 12/43 (28%)
LDL-receptor class B 20. {ECO:0000255} 2065..2108 14/44 (32%)
FXa_inhibition 2160..2195 CDD:291342 19/37 (51%)
YvrE 2254..2464 CDD:225921 42/212 (20%)
LDL-receptor class B 21. {ECO:0000255} 2254..2295 7/41 (17%)
LDL-receptor class B 22. {ECO:0000255} 2296..2344 11/50 (22%)
LDL-receptor class B 23. {ECO:0000255} 2345..2389 14/44 (32%)
Ldl_recept_b 2345..2386 CDD:278487 13/41 (32%)
LY 2371..2412 CDD:214531 8/41 (20%)
LDL-receptor class B 24. {ECO:0000255} 2390..2432 5/42 (12%)
LDL-receptor class B 25. {ECO:0000255} 2433..2474 9/42 (21%)
FXa_inhibition 2483..2515 CDD:291342 3/32 (9%)
LDLa 2528..2558 CDD:238060 5/30 (17%)
LDLa 2567..2601 CDD:238060 4/34 (12%)
LDLa 2606..2640 CDD:238060 9/34 (26%)
LDLa <2667..2689 CDD:238060 11/22 (50%)
LDLa 2697..2731 CDD:238060 15/34 (44%)
LDLa 2735..2766 CDD:197566 14/32 (44%)
LDLa 2774..2807 CDD:197566 1/7 (14%)
LDLa 2818..2850 CDD:197566
LDLa 2858..2891 CDD:197566
LDLa 2908..2940 CDD:238060
cEGF 2963..2986 CDD:289433
EGF_CA 2983..>3012 CDD:214542
LY 3050..3094 CDD:214531
LDL-receptor class B 26. {ECO:0000255} 3070..3114
LY 3095..3137 CDD:214531
LDL-receptor class B 27. {ECO:0000255} 3115..3157
LY 3139..3181 CDD:214531
LDL-receptor class B 28. {ECO:0000255} 3158..3201
LY 3183..3224 CDD:214531
LDL-receptor class B 29. {ECO:0000255} 3202..3244
LY 3225..3265 CDD:214531
LDL-receptor class B 30. {ECO:0000255} 3245..3285
FXa_inhibition 3295..3331 CDD:291342
LDLa 3335..3366 CDD:238060
LDLa 3375..3409 CDD:238060
LDLa 3414..3449 CDD:238060
LDLa 3453..3486 CDD:197566
LDLa 3494..3527 CDD:197566
LDLa 3537..3571 CDD:238060
LDLa 3576..3610 CDD:238060
LDLa 3614..3648 CDD:238060
LDLa 3654..3686 CDD:197566
LDLa 3696..3732 CDD:238060
LDLa 3747..3777 CDD:238060
LDL-receptor class B 31. {ECO:0000255} 3913..3955
Recognition site for proteolytical processing. {ECO:0000255} 3941..3944
LY 3956..3993 CDD:214531
LDL-receptor class B 32. {ECO:0000255} 3971..4013
LDL-receptor class B 33. {ECO:0000255} 4014..4057
Ldl_recept_b 4014..4054 CDD:278487
LY 4038..4079 CDD:214531
LDL-receptor class B 34. {ECO:0000255} 4058..4102
Interaction with MAFB. {ECO:0000269|PubMed:15135046} 4446..4545
NPXY motif 4503..4508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102227933
eggNOG 1 0.900 E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126933
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.