DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and HMGB3

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:94 Identity:27/94 - (28%)
Similarity:48/94 - (51%) Gaps:4/94 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DRVKRPMNAFMVWSRGQRRKMASDNPKMHN-SEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHM 240
            ::.|||.:||.|:....|.....::||..: :.:.|..|.:||.||:|||.|::.:|.:.:..:.
plant    33 NKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYE 97

  Fly   241 KEHPDYKYR---PRRKTKTLTKTKEKYPM 266
            |....|..:   ..||.:.||...::..|
plant    98 KNMKAYNKKLVIALRKMRNLTSQFQRLTM 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 22/78 (28%)
HMGB3NP_001031075.1 HMG-box_AtHMGB1-like 36..96 CDD:438821 20/59 (34%)

Return to query results.
Submit another query.