DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and HMGB2

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_564123.1 Gene:HMGB2 / 838658 AraportID:AT1G20693 Length:144 Species:Arabidopsis thaliana


Alignment Length:106 Identity:27/106 - (25%)
Similarity:49/106 - (46%) Gaps:14/106 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LTGGSSNNNNNSATANKNQQHA-------------DRVKRPMNAFMVWSRGQRRKMASDNPKMHN 206
            :.|..|.....|:..:..::.|             ::.|||.:||.|:....|.....:|||..:
plant     1 MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKS 65

  Fly   207 -SEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDY 246
             :.:.|..|.:||.||:|||.|::.:|::.:..:.|....|
plant    66 VATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAY 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 23/71 (32%)
HMGB2NP_564123.1 HMG-box_AtHMGB1-like 39..99 CDD:438821 21/59 (36%)

Return to query results.
Submit another query.