DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and 3xHMG-box2

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:127 Identity:30/127 - (23%)
Similarity:64/127 - (50%) Gaps:5/127 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TQQQQHGQQQHLGAGSALSSLTGGSSNNN---NNSATANKNQQHAD--RVKRPMNAFMVWSRGQR 194
            :|:::..:...|....||..|......:|   ...||..|..::.|  :.|:|.:::.::|:.:|
plant   330 SQKKEEEELLKLHKQEALQMLKKKEKTDNLIKKEKATKKKKNENVDPNKPKKPASSYFLFSKDER 394

  Fly   195 RKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKT 256
            :|:..:.|..:|:.::..:..:||:|||.||:.:..:|.:|...:.||...|..:....|.:
plant   395 KKLTEERPGTNNATVTALISLKWKELSEEEKQVYNGKAAKLMEAYKKEVEAYNKKSAATTSS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 20/76 (26%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 29/123 (24%)
HMG-box_AtHMGB6-like_rpt1 139..206 CDD:438822
HMG-box_AtHMGB6-like_rpt2 255..320 CDD:438823
HMG-box_AtHMGB6-like_rpt3 371..447 CDD:438824 19/75 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.