DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and TFAM

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens


Alignment Length:103 Identity:24/103 - (23%)
Similarity:52/103 - (50%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            |:|:::::.:|:.|.....:.||....:|:.:|:..:|::|.:|:|:.:.|..:....|:.:|..
Human    51 KKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEIS 115

  Fly   245 DYKYR--PRR-------------KTKTLTKTKEKYPMG 267
            .:|.:  |.:             |.|.:||.||...:|
Human   116 RFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 17/73 (23%)
TFAMNP_003192.1 HMG-box_TFAM_rpt1 50..115 CDD:438802 15/63 (24%)
HMG-box_TFAM_rpt2 135..234 CDD:438803 7/19 (37%)

Return to query results.
Submit another query.