DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and LOC4577482

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_001238271.1 Gene:LOC4577482 / 4577482 VectorBaseID:AGAMI1_010672 Length:111 Species:Anopheles gambiae


Alignment Length:101 Identity:27/101 - (26%)
Similarity:53/101 - (52%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 ADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQW---KDLSESEKRPFIDEAKRLRA 237
            |::.|||::|:|:|....|.::..:||.:..:||:|:.|..|   ||.||.|.:     |.:::.
Mosquito     2 AEKPKRPLSAYMLWLNSAREQIKKENPGIKVTEIAKKGGELWRGMKDKSEWEYK-----AAKMKD 61

  Fly   238 VHMKEHPDYK----------YRPRRKTKTLTKTKEK 263
            .:.|:..|::          .:.:...|.:.|:|:|
Mosquito    62 EYNKQMQDFERNGGSKDAGTKKKKGAKKVVKKSKKK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 22/87 (25%)
LOC4577482XP_001238271.1 HMG-box_SSRP1-like 7..71 CDD:438810 21/68 (31%)

Return to query results.
Submit another query.