DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and Hmgb3

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001385705.1 Gene:Hmgb3 / 305373 RGDID:1564407 Length:241 Species:Rattus norvegicus


Alignment Length:81 Identity:27/81 - (33%)
Similarity:49/81 - (60%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ATANKNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDE 231
            |...|.::..:..|||.:.|.::....|.|:.|.||.:...:::|:||..|.:||:|||:|::.:
  Rat   122 AKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSANPGISIGDVAKKLGEMWNNLSDSEKQPYMTK 186

  Fly   232 AKRLRAVHMKEHPDYK 247
            |.:|:..:.|:..|||
  Rat   187 AAKLKEKYEKDVADYK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 25/71 (35%)
Hmgb3NP_001385705.1 HMG-box_HMGB_rpt1 54..117 CDD:438794
HMG-box_HMGB_rpt2 132..202 CDD:438795 23/69 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.