DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox14

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001093703.1 Gene:sox14 / 100101715 XenbaseID:XB-GENE-485370 Length:239 Species:Xenopus tropicalis


Alignment Length:56 Identity:10/56 - (17%)
Similarity:18/56 - (32%) Gaps:22/56 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 WGKTLNR-----FHS-----------------ALILRATFLPIVHRDNCQKAYRRT 190
            ||.|.|.     .|:                 ||:....|...::|.....:::|:
 Frog   159 WGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 2/14 (14%)
sox14NP_001093703.1 HMG-box_SoxB 6..85 CDD:438790
SOXp 77..>95 CDD:463537
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.