DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bab2 and BtbVII

Sequence 1:NP_523879.2 Gene:bab2 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:952 Identity:219/953 (23%)
Similarity:329/953 (35%) Gaps:333/953 (35%)


  Fly   196 QQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYDNPCQHP 260
            |||||||||:|.|..:|...||.:.:.|||||:.||..::|||:||||||.||||||..||||||
  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQHP 68

  Fly   261 IIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAEVSAGRGEGGASALPMSA 325
            |:|::||.:.|||.:|:|||.||:||.|:|:..:||.||.|||:||||                 
  Fly    69 IVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAE----------------- 116

  Fly   326 FDDEDEEEELASATAILQQDGDADPDEEMKAKRPRLLPEGVLDLNQRQRKRSRDGSYATPSPSLQ 390
                                                :|....:|.:...|.|.||:      .:.
  Fly   117 ------------------------------------MPTDPANLTKSDSKSSTDGT------EMV 139

  Fly   391 GGESEISERG-SSGTPGQSQSQPLAMTTSTIVRNPFASPNPQTLEGRNSAMNAVANQRKSPAPTA 454
            ||....:..| |:|:.|       |.:.|::..:.::|...|..:.:        .|:::.....
  Fly   140 GGAGVGTGAGNSAGSLG-------AGSGSSVGDSLWSSSEAQQFQQQ--------QQQQAQQQAQ 189

  Fly   455 TGHSNGNSGAAMHSPPGGVAVQSALPPHMAAIVPPPPSAMHHHAQQLAAQHQLA--HSHAMASAL 517
            ..|.:......:.........|.....|          ..|||.||.:.|.|.|  |.|.|....
  Fly   190 QQHHHHQQQQQLQQQQQQAQQQQQQQQH----------HHHHHQQQQSGQAQAAQTHHHQMRRTP 244

  Fly   518 AAAAAGAGAA-------GAGGAGSGSGSGASAPTGGTGVAGSGAGAAVGSHHDDMEIKPEIAEMI 575
            :..:||...|       .:...|||..:.|......:..||||||.|..|          :|:|.
  Fly   245 SPLSAGTSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLS----------LAQMN 299

  Fly   576 REEERAKMIESGGHGGWMGAAAAATGAASVAADSYQYQLQSMWQKCWNTNQQNLVQQLRFRERGP 640
            :        .:.|.||  |.|..:..||.:..:|...:|:...|.                    
  Fly   300 Q--------MTFGAGG--GLAGHSLHAAKLLKESASAELEQQPQD-------------------- 334

  Fly   641 LKSWRPEAMAEAIFSVLKEGLSLSQAARKFDIPYPTFVLYANRVHNMLGPSLD-GGADPRPKARG 704
                          |.|.:|                    ...:|..:.|.:| ||.:     :.
  Fly   335 --------------SDLDDG--------------------HGHLHMQIKPEVDIGGVN-----QT 360

  Fly   705 RPQRILLGMWPEELIRSVIKAVVFRDYREIKEDMSAHQYANGQGHGTY-----IGGGTTTNGYHS 764
            .|..|..|..|.|              .:.....|:|...: ..|..:     :|..::::|...
  Fly   361 MPLDISGGTTPSE--------------HDAPNSQSSHSEPS-PAHAPHPPHPPLGAASSSSGGSG 410

  Fly   765 A--AAAKLAAQNAALAPPDAGSPLS-SMTETLRRQILSQQQQHQQHHQQQAHHQQQPSHHQQQSP 826
            :  .:..:....:....|| |:|.| ::..|.|.::|::|.:.::       .....|...|.||
  Fly   411 SFERSFSIGGVGSVECDPD-GTPSSPAVMGTKRNRVLTRQPRVKR-------DSDSISSTNQISP 467

  Fly   827 HAQSMNMYKSPAYLQRSEIEDQVSAAAAVAAAA-------AKHQQQQG---------------ER 869
            ...:..:...|           .:||.|.:|.|       :.|...|.               ||
  Fly   468 DTAATTLDFDP-----------FNAAGATSATARDYSTTGSHHLHHQSAVHHHHHLLTVPPRIER 521

  Fly   870 RGSENLPDLSALGLMGLPGLNVMPSRGSGGGSGGAAPNSAASYARELSRERERDRERERERELSR 934
            ..||..|.|:.    ..|.|..:||         :.|.....::..|               |.|
  Fly   522 HASEPAPSLAP----STPHLLSVPS---------STPYLIKQHSDPL---------------LPR 558

  Fly   935 QYGSQSRGSSSGSGSAKSLTASQRPGAASPYSAAH--YAKHQASAYNKRFLE----------SLP 987
            |......||.|||.||.:.       .::|::..|  |: |..|..|..::.          |||
  Fly   559 QSALHMAGSGSGSSSAMAT-------GSNPFAPLHRQYS-HPLSGSNASYVTPAPLHHPHHISLP 615

  Fly   988 AGIDLEAFANGLLQKSVNKSPRFEDFFPGPGQDM--------------SELFANP-------DAS 1031
            ..|    :|:|        ||      |..|...              ||..|.|       .::
  Fly   616 ESI----YASG--------SP------PPAGSSQYLVPTRVVACPVVSSETAATPTNASPGSSST 662

  Fly  1032 AAAAAAAYAPPGAIRE--------SPLMKIKLEQQHATELPH 1065
            .:||.:....|.|..:        ||...|..:..|....||
  Fly   663 VSAAVSVVTSPNAGLQNSASRHPLSPTFSIGSDVAHERRSPH 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bab2NP_523879.2 BTB 213..309 CDD:279045 58/96 (60%)
BTB 224..309 CDD:197585 55/85 (65%)
HTH_psq 645..690 CDD:283007 4/45 (9%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 58/146 (40%)
BTB 32..117 CDD:197585 55/138 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5233
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.