DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bgm and CG6300

Sequence 1:NP_001285923.1 Gene:bgm FlyBaseID:FBgn0027348 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster

Alignment Length:495 Identity:96/496 (19%)
Similarity:173/496 (35%) Gaps:137/496 (28%)


  Fly    88 QVAKAFIKLGLEEHHSVGVL----------AFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQH 142
            ::|.....|||.:...||::          |:.|   |::.: |.|:..|      |...|.::.
  Fly    68 RLASYMRSLGLLQSDIVGIIGRNTTHMLAVAYAC---FFNGI-AFHSLNI------TYDRDTIEK 122

  Fly   143 VLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKEDGYYRWSEIESMNVSDV 207
            :.:.:...|:..|.    |:...:|....:|...|...              |...::|:.:.:|
  Fly   123 IYKVTRPSIIFCDG----DEFEKVRSATAELDVKIVTM--------------RNHPLDSIKIDEV 169

  Fly   208 -----EDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGAESI 267
                 |:.:.........::...::.:|||.|.||.|.:::..                      
  Fly   170 VATPIEENFQPAKLEKGNDQTLAILCSSGTTGTPKAVTITNSR---------------------- 212

  Fly   268 VSYLPLSHVAA-----QTVDIY----TCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRV 323
                   |:.|     .|.|:.    |..::.|.:..........|.:.:.....|...:   |:
  Fly   213 -------HILAGNYHLTTADVQYSHNTLDWITGLLTTITSGVFSTTRIIADNAFDPAFAL---RI 267

  Fly   324 YEKFQERMVAVASSSGSLKKMLASW--AKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALG 386
            .|:::........||.:|......:  ....:|:.||.      ||.|   |...:...::..|.
  Fly   268 IEEYKVTWTIQPPSSMALMINCPDFETCDMSSLRCYMF------GGSR---AALEVQKGIRSRLS 323

  Fly   387 FDRVLTLASAAAPMSPETKKYFLSLDLKIVDAF---GMSETAGCHTICLPDSVGLNTIGKTLPGC 448
            .|                       .|:.|..|   |...|..||   ..:..|  ::|:.:.|.
  Fly   324 HD-----------------------CLQFVYGFTELGAMATINCH---FDEKTG--SVGQLVNGL 360

  Fly   449 ESKFINKDANG-----HGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLT 508
            :.|.||.|...     .||:||.....:.||..|:.:|....|...|.||||||::|..|::.:.
  Fly   361 KMKIINDDGESLGPDEIGEVCIMNNQHWSGYYGNEVETRNMRDSLGWYHSGDLGYMDRDGFLYIM 425

  Fly   509 GRSKEIIITAGGENIP--PVHIENTIKKELDAISNAFLVG 546
            .|.||::   ..:||.  |..||:.| .|:..::...:.|
  Fly   426 DRKKEML---KYQNIMYYPNDIESVI-SEMPQVAEVCVFG 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bgmNP_001285923.1 FAA1 32..666 CDD:223953 96/496 (19%)
ACSBG_like 69..665 CDD:213299 96/496 (19%)
CG6300NP_650828.1 CaiC 26..523 CDD:223395 96/496 (19%)
AFD_class_I 47..522 CDD:302604 96/496 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92602873
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.