DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bgm and acs-10

Sequence 1:NP_001285923.1 Gene:bgm FlyBaseID:FBgn0027348 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_506502.1 Gene:acs-10 WormBaseID:WBGene00007082 Length:566 Species:Caenorhabditis elegans

Alignment Length:576 Identity:134/577 (23%)
Similarity:228/577 (40%) Gaps:138/577 (24%)


  Fly    79 YKQYEQKVHQVAKAFIKLGLEEHHSVGVLAF-NCAEWFYSAMGAIHARGIIAGIYTTNSADAVQH 142
            |:..|..|:.:|.|.:|||.:. ..|...|| ||.|:..:.:..:...|.::......:...:|.
 Worm    50 YRDVEPTVNSLATALVKLGFKP-GDVAAQAFPNCPEFLIAMLAVMKCGGAMSNASAIFTDYELQL 113

  Fly   143 VLESSHAQIVVVDDAKQMDKIHAIR---DKLPKLKAAIQIQE-PYSPYLKKEDGYYRWSEIESMN 203
            ..:.|:..||..|:    |::..:|   .|.|.::..|.::. |    |:.|   :..:.::.:.
 Worm   114 QFKDSNTSIVFTDE----DRLARVRRSVAKCPGVRKIICLRTFP----LRAE---FPENVLDFVE 167

  Fly   204 VSDVEDQYMTRLENVAI--NECCCLVYTSGTVGMPKGVMLSHDNIT--FDV------RGIVKAM- 257
            ::...||.:    ||.:  :....|.|:|||.|.|||..|:|.||:  .|:      ..:.:|| 
 Worm   168 LTQTPDQPI----NVVVSPDAIALLPYSSGTTGRPKGCQLTHKNISAMLDIAQSHLETEVAQAMF 228

  Fly   258 --DRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGV 320
              ::.....|.::..||..|.......:.|....|..:                           
 Worm   229 GKEKPTWNKEHVLLLLPWYHAYGLNTMLETILLGATGL--------------------------- 266

  Fly   321 PRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQAL 385
              |::||.   ..|..:.....|:..:|    .:...::...|......:.:|..|   ||..:.
 Worm   267 --VFKKFD---TIVMLNRIKFYKVKLAW----LVPPMLIFLAKDPMVPIFNVAPYL---KVIMSA 319

  Fly   386 GFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTI-------CLPDSVGLNTIGK 443
            |       |:|...:..|.:|.|.:..|  ..|:||:|.....|:       |      ..|:|.
 Worm   320 G-------ATAGKQLCEEVQKRFPNAWL--CQAYGMTEMVQFTTLPIFEHGNC------FETVGS 369

  Fly   444 TLPGCESKFINKD------ANGHGELCIRGRHVFMGYIDNKEKTEES--LDDDCWLHSGDLGFVD 500
            ..|..|.|.::|:      .:..|:||.||..:..||:    |.|||  :|.|.:|.:||||.||
 Worm   370 LGPTYEMKILDKEGKEVDKTDTVGQLCFRGPTIMKGYL----KKEESDIIDKDGFLKTGDLGSVD 430

  Fly   501 DKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVG---EQ-----RKYLTVLIT 557
            .||.|.:|||.|| :|...|..:|||.||:.:... ..:.:..::|   ||     |.|:.....
 Worm   431 QKGRVHVTGRIKE-LIKVNGMQVPPVEIEDVLLLH-PKVKDCAVIGIPDEQKGESPRAYIVKKDH 493

  Fly   558 LKTEVDKDSGEPLDELSHE---SSVWV------------KSLGVEHKTVSDILAAG 598
            ..||.:      |.:..|:   |..|:            .|..::.|.:.::.|.|
 Worm   494 TLTEAE------LSDFVHKMLSSYKWIDTYEFIDAIPKLPSGKIQRKKLKEMAAGG 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bgmNP_001285923.1 FAA1 32..666 CDD:223953 134/577 (23%)
ACSBG_like 69..665 CDD:213299 134/577 (23%)
acs-10NP_506502.1 CaiC 17..544 CDD:223395 134/577 (23%)
Firefly_Luc_like 37..532 CDD:213279 131/564 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92638613
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.