DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Patj and CG15803

Sequence 1:NP_477342.1 Gene:Patj FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster

Alignment Length:896 Identity:310/897 (35%)
Similarity:431/897 (48%) Gaps:231/897 (26%)


  Fly   141 ATDYAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEM 205
            :|:::|::.|:|:|||.||||.::|.|::||::|.:.|||||::||||:.|||:||||:|||...
  Fly     4 STEWSQVEVIDLINDGNGLGFILVGGRSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGF 68

  Fly   206 VSEQVAAVLRQSGTHVRLVVARPVEQSVPTPQYALEPGTAVVPTRVLVDPAELERYLIST----- 265
            .|||||.||||:|..|||:||||||.:....| .|.....::||::|.||.||.|:|...     
  Fly    69 SSEQVATVLRQTGAQVRLIVARPVEPTAIDYQ-TLACQAPIIPTKLLSDPEELSRHLFQNPSFAT 132

  Fly   266 -------------------------------------GYPEIFGESSTASTPQTTTEDDRFVYRG 293
                                                 |.| ..|...:|..||.:....:.....
  Fly   133 AAVAAAAAAAAAAGSGSDGDVGGGGVLDVASLVGLVRGGP-AEGTELSAVEPQPSAAVLQLQQLS 196

  Fly   294 ET------------------SMLID--------PNIDLE-------------------------- 306
            |.                  ||:.|        |.:||:                          
  Fly   197 ELAGDLADFPLPPIPGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPPPRPALQMLPLETQWRC 261

  Fly   307 -----------------ELLA--------------------LPETEKLQVELKKDANGLGITIAG 334
                             :|||                    .||||...|||.|:..|||||:||
  Fly   262 VQDQNRHIETVIADSKRKLLANEDGGSASASGSGSPDSYMDSPETETYVVELHKNVYGLGITVAG 326

  Fly   335 YVCEKEELSGIFVKSVSPGSAADLSGRIRVNDRIIEVDGQSLQGYSNHQAVELLKKSGQVVNLRL 399
            ||||:|:||||||||:..||||:.||:|::||||:.|||:||.|.:||||||||:.:..||:|.|
  Fly   327 YVCEEEDLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTL 391

  Fly   400 ERYLRGPKFEQLQQAIA--ANDKLPS----------------SAPGTPSRAP---MPTPVATTSS 443
            ||:|||.|:|.||.|:.  .....||                |.||:||.|.   :|.......|
  Fly   392 ERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQDKDQDQESQLSMPGSPSIATLSWLPPKSLDADS 456

  Fly   444 ATTTPSRSITRE------LEEEALPAPEAFMTTPPSVTTMTTTTLSSFGAGKQLVAVRDSLD--- 499
            ..|....::..|      .|:|.:..|             :..|:.|     .:..|.|..|   
  Fly   457 IATEGDEAVDAEYVGISGAEDEFIELP-------------SRDTVES-----NMSHVLDRSDHSG 503

  Fly   500 GSTKIIPTEVVPLADKTEAKNSGVITRHKYYTDPELSD-DAETEIIRKWQKIVGSDVEVI----- 558
            |.||.....:.|:...|..::..:.......||.:.:: :.||...||..|.....|:.:     
  Fly   504 GLTKDQVPRISPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKPETERVKDLGDTKT 568

  Fly   559 ------------------VAQIK---------KFAVGGLGISLEGTVDVEGGREVRPHHYIRSIL 596
                              .|.:|         :.|...||||||||||||.|.|.||||||||||
  Fly   569 DTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISLEGTVDVECGIEKRPHHYIRSIL 633

  Fly   597 PDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGRNR------NSSLLPF 655
            .|||||..|:||.|||||:||..:|.|:.|:|||.||||||..|::||.|..      |:|..|.
  Fly   634 ADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHVPSVINTSQNPE 698

  Fly   656 SDDTLKKLSNNFENLLPATDRLVKAKSDGSLATAGSVADGDSVAAAAASFSK----LKSRSLEPL 716
            :.:|...|....::|   .:.|.||:|:.||.|:.:....|:.|||..|...    .:|:|||.:
  Fly   699 AFETRSLLPGGHQSL---QNLLSKAQSESSLYTSSTATLTDAGAAAGGSGGTAGGGARSKSLENV 760

  Fly   717 TGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLF 781
            :|||:||.:...:::.|.::|.||||||||||||...::||||.|:.||.|:....:.|||||:.
  Fly   761 SGLALWSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMS 825

  Fly   782 VNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSLKACSNASTTS 832
            |....|:...||:||..||....|:.|:|:.:||..:|::    ||::..|
  Fly   826 VGDRLLQGLELDEAVSILKAMPPGLTRLGICRPLSASDSN----SNSNIAS 872

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425
PDZ_signaling 154..226 CDD:238492 45/72 (63%)
PDZ_signaling 318..400 CDD:238492 53/82 (65%)
PDZ_signaling 557..643 CDD:238492 55/118 (47%)
PDZ_signaling 726..807 CDD:238492 36/81 (44%)
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 45/72 (63%)
PDZ 307..393 CDD:214570 55/86 (64%)
PDZ_signaling 605..680 CDD:238492 52/75 (69%)
PDZ 773..858 CDD:214570 38/85 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4699
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001197
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19964
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.