DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Patj and unc-10

Sequence 1:NP_477342.1 Gene:Patj FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:NP_741831.1 Gene:unc-10 WormBaseID:WBGene00006750 Length:1563 Species:Caenorhabditis elegans

Alignment Length:686 Identity:150/687 (22%)
Similarity:241/687 (35%) Gaps:205/687 (30%)


  Fly    25 DDPKLQMQTAESLSTILGILQDPVFRTIVHVQDSLSELNAQLAQHPSMLPNDFDIDVAGNLVLSL 89
            :..|.:..:::|.|...|:...|  .|..|:....:.|:.||.   ||..::.|| :||      
 Worm   437 ESKKQRNNSSQSQSNTQGVRACP--STDDHLNRVKNRLHRQLR---SMSSSEEDI-IAG------ 489

  Fly    90 NGGEVMYDFDEQRSSSHSHSAPGSP----DKSGGVGEEPRPQSQNSKGAGVADLYATDYAQIQAI 150
            .||..:      :.|:.:..|.|..    |..|....:...:..||:    .||....|...:. 
 Worm   490 GGGNTL------KMSTSAVVASGGKTAFHDDMGASNVQRLSEECNSE----KDLLRYIYGDHKN- 543

  Fly   151 ELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLR 215
               :|.:.||.|:.|:..          |||...:..|:|..|.|..|..               
 Worm   544 ---SDSSSLGAGVGGSGG----------GGVLSGNSVLKSKSHALLKGSY--------------- 580

  Fly   216 QSGTHVRLVVARPVEQSVPTPQYALEPGTAVVPTRVLVDPAELERYLISTGYPEIFGESSTASTP 280
            |.|..::....|....|                    :.|:..:.:    |...|.|....||..
 Worm   581 QGGLDMQANRRRDKSLS--------------------LSPSRNDHF----GTGSISGGDLLASRI 621

  Fly   281 QTTTEDDRFVYRGETSMLIDPNIDLEELLA---LPETEKLQVELKKDANG-LGITIAGYVCEKEE 341
            :|      |:....|   ..|:.|.::|:.   |..||      ...||| ||:.|.|.......
 Worm   622 RT------FLSHPVT---WQPSADQKKLIGHMILHRTE------NSAANGDLGLKIVGGRRTDTG 671

  Fly   342 LSGIFVKSVSPGSAADLSGRIRVNDRIIEVDGQSLQGYSNHQAVELLKKSGQVVNLRLERYLRGP 406
            ..|.|:..|.|||.||..||:|..|.::|.:|||||..:                          
 Worm   672 KLGAFITQVKPGSVADTIGRLRPGDEVVEWNGQSLQNAT-------------------------- 710

  Fly   407 KFEQLQQAIAANDKLPSSAPGTPSR-APMP--------TPVATTSSATTTPSRSITRELEEEALP 462
             :||:..:|||: :..:|.....|| |.:|        ||...:|||.:....:...:.:.: ||
 Worm   711 -YEQVYDSIAAS-RYDTSVELIVSRSAIIPGGDDFLNLTPSQMSSSAYSRVPSAYPSQFQRQ-LP 772

  Fly   463 APEAFMTTPPSVTTMTTTTLSSFGAGKQLVAVRDSLDGSTKIIPTEVVPLADKTEAKNSGVITRH 527
            .|:.|:...|::              :||     ||..|    .:.|.|..:...::|..  |..
 Worm   773 NPDLFLDIHPAL--------------QQL-----SLPHS----QSAVFPHNNTLTSRNRS--TSS 812

  Fly   528 KYYTD-PELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGG-----LGISLEGTVDVEGGREV 586
            .||:| |:|...:.    |:.|:........|..:|:...|..     |.::|....|:....:.
 Worm   813 YYYSDVPDLGVPSN----REMQESQAFGTGHIFGRIEVSFVYSHHDRQLSVALVRGFDLPPRSDG 873

  Fly   587 RPHH-YIR-SILPD--------GPVGVNGVLRSGDELLEVNG-------ERLL----------GM 624
            .|.: |:: .:|||        ..|....::...||:...||       :|:|          |.
 Worm   874 TPRNPYVKIFLLPDRSEKSRRQSAVIAETLMPVWDEVFYYNGLTEPMLLQRVLELTVWDYDKFGT 938

  Fly   625 NHL--EVVAILKELPLDVRMVCGRNRNSSLLPFSDD 658
            |..  |.:..|..:|||     |.:....:|...||
 Worm   939 NSFLGETLIDLASVPLD-----GEHSLMCILVDMDD 969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425 10/45 (22%)
PDZ_signaling 154..226 CDD:238492 15/72 (21%)
PDZ_signaling 318..400 CDD:238492 25/83 (30%)
PDZ_signaling 557..643 CDD:238492 25/120 (21%)
PDZ_signaling 726..807 CDD:238492
unc-10NP_741831.1 PHD_SF 11..130 CDD:304600
PDZ_signaling 643..731 CDD:238492 34/122 (28%)
DegQ <674..755 CDD:223343 32/109 (29%)
C2A_RIM1alpha 840..963 CDD:175997 26/128 (20%)
C2B_RIM1alpha 1402..1548 CDD:175994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.