DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Patj and grip2

Sequence 1:NP_477342.1 Gene:Patj FlyBaseID:FBgn0067864 Length:871 Species:Drosophila melanogaster
Sequence 2:XP_002938276.2 Gene:grip2 XenbaseID:XB-GENE-854056 Length:1075 Species:Xenopus tropicalis

Alignment Length:928 Identity:194/929 (21%)
Similarity:321/929 (35%) Gaps:290/929 (31%)


  Fly   114 PDKSGGVGEEPRPQSQNSKGAGVADL--------YATDYAQIQAIELV-NDGTGLGFGIIGA--R 167
            |.|..|      |.|:.:|.....||        ...::..:..:||: .:|:.||..|.|.  :
 Frog    12 PTKDDG------PYSKGNKDPAGNDLALVSRRQSIPEEFRGVTIVELIKKEGSTLGLTISGGTDK 70

  Fly   168 NSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVARPVEQS 232
            :....|..:..||:|.:..:|..||:|..:..:||.::..|::.::|:..|..|.|.|       
 Frog    71 DGKPRVSNLRSGGLAARSDQLNIGDYIKSVNGINLTKLRHEEIISLLKNVGERVVLEV------- 128

  Fly   233 VPTPQYALEPGTAVVPTRVLVDPAELERYLISTGYPEIFGESSTASTPQTTTEDDRFVYRGETSM 297
                :|.|.|.|.                           ::|:|..|:|               
 Frog   129 ----EYELPPATP---------------------------DNSSAIIPKT--------------- 147

  Fly   298 LIDPNIDLEELLALPETEKLQVELKKDANGLGITIAGYVCEKEELS-GIFVKSVSPGSAADLSGR 361
                               :::.|.|:.|..|..:.|...|....| .:.|..|.||..||..|.
 Frog   148 -------------------IEITLCKEGNSFGFVMRGGAHEDWHKSRPLVVTYVRPGGPADREGT 193

  Fly   362 IRVNDRIIEVDGQSLQGYSNHQAVELLKKSGQVVNLRLE---------RYLRGPKFEQL------ 411
            ::|:||::.|||.||...::..|:.:|::..|....::|         ....||...::      
 Frog   194 LKVSDRLLCVDGISLHNITHTDALSILRQCSQEAVFQIEYDVALMDTVTNASGPLLVEIAKTPGS 258

  Fly   412 -------------QQAIAANDKLPSSA--------PGTP--SRAPMPTPVATTSSATTTPSRSIT 453
                         :|.|..:...|:|.        ||..  |.....|...|...||...: ||.
 Frog   259 TLGISLSTGTHRNKQVIVIDKVKPASVVDRCGALHPGDHILSIDGTSTEHCTLMEATQLLA-SII 322

  Fly   454 RELEEEALPAPEAFMTTPPSVT----------------------------TMTTTTLSSFGAGKQ 490
            ..::.|.|||..:.::..|..|                            |.|..:.|:....|.
 Frog   323 ENVKLEILPAHHSRLSLRPPETVKVQKSDHHHCWDPCVNYCHTPHPGHCKTPTWNSTSNQEYCKS 387

  Fly   491 LVAVRDSLDGSTKIIPTEVVPLADKTEAKNSGVITRHKYYTDPELSDDAETEIIRKWQK------ 549
            |||...|   |:.:..|      ....::||..:.|..:...|      .|.:.|:.||      
 Frog   388 LVAANFS---SSSVAGT------PGFSSQNSNTLPRTAHPMSP------RTTMSRRRQKRKDHKS 437

  Fly   550 -------IVGSDVEVIVAQ-----IKKFAVGGLGISLEGTVDVEGGREVRPHHYIRSILPDGPVG 602
                   .||...::|..:     ::...:.|.||.|:|.:.........|  .||.|.||.|..
 Frog   438 SLSLASSTVGPGGQIIHTESTEIILRGDPLNGFGIQLQGGIFATETLSSPP--LIRFIEPDSPAE 500

  Fly   603 VNGVLRSGDELLEVNG-----ERLLGMNHLEVVAILK-----ELPLDVRMVCGRNRNSSLLPFSD 657
            ..|:|:.||.||.:||     ..|...|.|...|.|.     |:..||.        .|::|.|.
 Frog   501 RCGLLQVGDRLLSINGILTEDGTLEEANQLLRDAALSNKVALEIEFDVA--------ESVVPSSG 557

  Fly   658 DTLKKLSN----------NFENLLPATDRLVKAKSDGSLA-TAGSVADGDSVAA----------- 700
            ....||..          :..:..|....::.....||:| ..|::..||.:.|           
 Frog   558 TFHVKLPKRKGVELGITISSASRKPGESLIISDIKKGSVAHRTGTLEPGDKLLAIDNIRLDNCSM 622

  Fly   701 --------AAASFSKLKSRSLE------PLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDP 751
                    ......|||.|..|      ..:|..:::     :||.:....||.:|...::|.||
 Frog   623 EDAVQILRQCEDLVKLKIRKDEDNSDEQETSGAIIYT-----VELKRYGGPLGITISGTEEPFDP 682

  Fly   752 NDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAK--- 813
                |||..|...|:|:..|.:..|||:|.:|:::|:...|.:|:..|:.|.: .|.:.:.|   
 Frog   683 ----IVISGLTKRGLAERTGAIHIGDRILAINNVSLKGKPLSEAIHLLQMAGE-TVTLKIKKQAE 742

  Fly   814 ---PLPMTDNSLKACSNASTTSEETLDAQPSPPALPTVAPPAMPP-------------SASMGAE 862
               |..::|:     .|..:..|:.|........|..:...|:|.             .|..|::
 Frog   743 RIFPQRLSDS-----MNEGSDPEDDLTDSQKTSKLSDIYSTAVPSVDSALESWDGSGIDAGYGSQ 802

  Fly   863 PDLIP----------DWR 870
            ...:|          :||
 Frog   803 GTYVPQAVGISLHPHEWR 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PatjNP_477342.1 L27 12..70 CDD:295425
PDZ_signaling 154..226 CDD:238492 21/74 (28%)
PDZ_signaling 318..400 CDD:238492 25/83 (30%)
PDZ_signaling 557..643 CDD:238492 29/101 (29%)
PDZ_signaling 726..807 CDD:238492 25/81 (31%)
grip2XP_002938276.2 PDZ_signaling 47..129 CDD:238492 23/93 (25%)
PDZ_signaling 147..232 CDD:238492 26/119 (22%)
PDZ_signaling 247..330 CDD:238492 15/84 (18%)
PDZ_signaling 459..545 CDD:238492 26/88 (30%)
PDZ_signaling 558..641 CDD:238492 13/83 (16%)
PDZ_signaling 657..738 CDD:238492 26/91 (29%)
PDZ_signaling 967..1044 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.