DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sns and Cadm1

DIOPT Version :10

Sequence 1:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster
Sequence 2:NP_001297770.1 Gene:Cadm1 / 54725 MGIID:1889272 Length:474 Species:Mus musculus


Alignment Length:433 Identity:108/433 - (24%)
Similarity:168/433 - (38%) Gaps:110/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LRLLAVIVLASAPVPSHAQQQKFRTTPHDLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAV 116
            ||||.:::.|:|.:|:...|..|   ..|:.|:||..|.:.|:|.....:|              
Mouse    29 LRLLLLLLSAAALIPTGDGQNLF---TKDVTVIEGEVATISCQVNKSDDSV-------------- 76

  Fly   117 IPGFPRYSVLGDRKQGIY--------------------NLRIS--NASINDDADYQCQV--GPAR 157
                  ..:|...:|.||                    .|::|  |.||:|:..|.||:  .|.:
Mouse    77 ------IQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQ 135

  Fly   158 LNSAIRANAKLTVISPPASIEIKGYSHNSKVEVRENQDLQLKCIVANAKPAAQIVWYRGNVEYKP 222
                 .:...:||:.||.::.|    ...|....|.:::::.|....:|||..|.|::||.|.|.
Mouse   136 -----ESYTTITVLVPPRNLMI----DIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKG 191

  Fly   223 EKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATVQLSVLYPPGPPY 287
            :..   ||| .:..:|.||.|.||...:||.....||..|.|::.::..:.  .|.|.|.|....
Mouse   192 KSE---VEE-WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQR--YLEVQYKPQVHI 250

  Fly   288 IEGYSAGETLRRGQTVELMCRSRGGNPPAQLIWYKNGSQIRMAYRTSGRLSENIYTFTAEAGDNK 352
            ...|......|.|...||.|.:.|...|..:.|.:...::......||   .|::.......|| 
Mouse   251 QMTYPLQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSG---PNLFINNLNKTDN- 311

  Fly   353 ARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTEARVGDIVPLTCTTAPSNPPAEIKWMVG 417
            ..:||||||::.:  ..::..|.|...||  |:..||          |.||..:           
Mouse   312 GTYRCEASNIVGK--AHSDYMLYVYDPPT--TIPPPT----------TTTTTTT----------- 351

  Fly   418 GRQVRNATSKTIVSPEGGWTTTSNITAVVEPNKRSLVVICHGL 460
                  .|:.||:      |..::.||..||       ..|||
Mouse   352 ------TTTTTIL------TIITDTTATTEP-------AVHGL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snsNP_001036532.1 Ig 73..170 CDD:472250 23/120 (19%)
Ig strand B 89..93 CDD:409559 1/3 (33%)
Ig strand C 101..105 CDD:409559 1/3 (33%)
Ig strand E 130..138 CDD:409559 4/27 (15%)
Ig strand F 148..153 CDD:409559 2/4 (50%)
Ig 173..279 CDD:472250 31/105 (30%)
Ig strand B 196..200 CDD:409418 0/3 (0%)
Ig strand C 210..214 CDD:409418 1/3 (33%)
Ig strand E 241..245 CDD:409418 2/3 (67%)
Ig strand F 255..260 CDD:409418 1/4 (25%)
Ig strand G 272..275 CDD:409418 0/2 (0%)
Ig_3 285..361 CDD:464046 18/75 (24%)
Ig 377..>457 CDD:472250 16/79 (20%)
Ig strand B 397..401 CDD:409418 0/3 (0%)
Ig strand C 411..415 CDD:409418 0/3 (0%)
Ig strand E 440..444 CDD:409418 0/3 (0%)
Ig 477..560 CDD:472250
Ig strand B 499..504 CDD:409418
Ig strand C 514..518 CDD:409418
Ig strand E 537..541 CDD:409418
Ig strand F 551..556 CDD:409418
Ig 584..666 CDD:472250
Ig strand B 595..599 CDD:409416
Ig strand C 609..613 CDD:409416
Ig strand E 636..642 CDD:409416
Ig strand F 652..657 CDD:409416
Ig strand G 667..670 CDD:409416
Ig 678..767 CDD:472250
Ig strand B 696..700 CDD:409353
Ig strand C 710..714 CDD:409353
Ig strand E 733..737 CDD:409353
Ig strand F 747..752 CDD:409353
Ig_3 772..847 CDD:464046
Ig 881..963 CDD:472250
Ig strand B 885..888 CDD:409353
Ig strand C 897..901 CDD:409353
Ig strand E 929..933 CDD:409353
Ig strand F 943..948 CDD:409353
FN3 967..1051 CDD:238020
Cadm1NP_001297770.1 IgV_1_Necl-2 50..143 CDD:409465 23/120 (19%)
FR1 50..68 CDD:409465 6/20 (30%)
Ig strand A 50..52 CDD:409465 1/4 (25%)
Ig strand A' 53..59 CDD:409465 2/5 (40%)
Ig strand B 61..69 CDD:409465 2/7 (29%)
CDR1 69..74 CDD:409465 1/4 (25%)
FR2 75..82 CDD:409465 2/26 (8%)
Ig strand C 75..81 CDD:409465 1/25 (4%)
CDR2 83..94 CDD:409465 3/10 (30%)
Ig strand C' 85..89 CDD:409465 2/3 (67%)
Ig strand C' 91..94 CDD:409465 0/2 (0%)
FR3 95..130 CDD:409465 9/34 (26%)
Ig strand D 99..106 CDD:409465 0/6 (0%)
Ig strand E 109..115 CDD:409465 2/5 (40%)
Ig strand F 122..130 CDD:409465 3/7 (43%)
CDR3 131..134 CDD:409465 0/2 (0%)
Ig strand G 134..143 CDD:409465 0/13 (0%)
FR4 136..143 CDD:409465 0/6 (0%)
IgI_2_Necl-2 144..242 CDD:409466 31/107 (29%)
Ig strand A 144..147 CDD:409466 0/2 (0%)
Ig strand A' 150..154 CDD:409466 1/7 (14%)
Ig strand B 163..173 CDD:409466 1/9 (11%)
Ig strand C 176..185 CDD:409466 4/8 (50%)
Ig strand C' 186..189 CDD:409466 1/2 (50%)
Ig strand D 191..198 CDD:409466 3/10 (30%)
Ig strand E 201..211 CDD:409466 4/9 (44%)
Ig strand F 219..227 CDD:409466 2/7 (29%)
Ig strand G 234..241 CDD:409466 0/8 (0%)
IG_like 255..333 CDD:214653 20/83 (24%)
Ig strand B 266..270 CDD:409353 2/3 (67%)
Ig strand C 279..284 CDD:409353 0/4 (0%)
Ig strand F 313..318 CDD:409353 2/4 (50%)
4.1m 427..445 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.