DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and Atp5f1e

DIOPT Version :10

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_080259.1 Gene:Atp5f1e / 67126 MGIID:1855697 Length:52 Species:Mus musculus


Alignment Length:40 Identity:18/40 - (45%)
Similarity:29/40 - (72%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVK 43
            ||.||::||::|.|.|:.:|::|||..:|:|.|...|.:|
Mouse     5 WRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:461373 18/40 (45%)
Atp5f1eNP_080259.1 ATP-synt_Eps 3..47 CDD:461373 18/40 (45%)

Return to query results.
Submit another query.