DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sls and CFP

Sequence 1:NP_001261304.1 Gene:sls FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:NP_001138724.1 Gene:CFP HGNCID:8864 Length:469 Species:Homo sapiens

Alignment Length:312 Identity:60/313 (19%)
Similarity:88/313 (28%) Gaps:105/313 (34%)


  Fly  2697 CKATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPKEGRP---EAPEPTYETPVFIT 2758
            |....|..||..|..:......|.......|.|....|....|||.|.   .||||:.:.|    
Human   174 CPGQAQESEAC
DTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPP---- 234

  Fly  2759 HLNNIECKESDNVRFE---------CNVEPARDP---------TMSIEWFYNGQPLQAAAKFKSI 2805
                  .|....:.:|         |.|.....|         |..:     ||.::.......:
Human   235 ------GKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGL-----GQTMEQRTCNHPV 288

  Fly  2806 YDFG--YCALDLTNSYAENSGV--------------YTCKATNSK--------GSATTSGTL--- 2843
            ...|  :||.|.|.::..|:.|              ..|...|.|        |..:...|.   
Human   289 PQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGR 353

  Fly  2844 -----KCTGGKTMFLDTQH------------------------PQGEAGLEAVQETEEELANRYT 2879
                 :|.|.:.   |.:|                        |.|.....|.|.....|..:|.
Human   354 KFDGHRCAGQQQ---DIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYP 415

  Fly  2880 SKTTKPETQYPPPV--WTKPLQ-------AEFHLSEAQP-IHLEANVEPKED 2921
            ...:..|.|....|  |.:||.       .:..:.|.:| :|:.|..:|:|:
Human   416 PTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEE 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:254352
Ig 109..175 CDD:143165
Ig 254..334 CDD:299845
I-set 255..344 CDD:254352
I-set 372..462 CDD:254352
Ig 390..463 CDD:299845
Ig 471..561 CDD:299845
I-set 471..560 CDD:254352
I-set 618..709 CDD:254352
Ig 645..705 CDD:143165
DUF1136 715..741 CDD:284093
IG_like 762..843 CDD:214653
Ig 779..835 CDD:143165
I-set 890..982 CDD:254352
Ig 918..979 CDD:143165
DUF1136 988..1014 CDD:284093
I-set 1024..1116 CDD:254352
Ig 1058..1113 CDD:143165
I-set 1158..1250 CDD:254352
Ig 1178..1246 CDD:143165
DUF1136 1256..1282 CDD:284093
I-set 1291..1380 CDD:254352
IGc2 1304..1372 CDD:197706
DUF1136 1388..1414 CDD:284093
I-set 1424..1515 CDD:254352
Ig 1442..1513 CDD:143165
DUF1136 1522..1548 CDD:284093
I-set 1558..1645 CDD:254352
IGc2 1571..1639 CDD:197706
DUF1136 1655..1679 CDD:284093
I-set 1691..1782 CDD:254352
IGc2 1718..1772 CDD:197706
DUF1136 1788..1814 CDD:284093
I-set 1824..1916 CDD:254352
IGc2 1838..1906 CDD:197706
DUF1136 1922..1948 CDD:284093
I-set 1958..2049 CDD:254352
Ig 1985..2044 CDD:143165
I-set 2089..2181 CDD:254352
IGc2 2103..2171 CDD:197706
DUF1136 2187..2213 CDD:284093
I-set 2222..2314 CDD:254352
IGc2 2236..2304 CDD:197706
DUF1136 2320..2346 CDD:284093
I-set 2356..2448 CDD:254352
Ig 2384..2445 CDD:143165
DUF1136 2454..2480 CDD:284093
I-set 2488..2580 CDD:254352
Ig 2516..2576 CDD:143165
I-set 2622..2714 CDD:254352 5/17 (29%)
IGc2 2636..2704 CDD:197706 2/7 (29%)
I-set 2754..2844 CDD:254352 21/140 (15%)
Ig 2771..2840 CDD:143165 18/111 (16%)
IGc2 2908..2974 CDD:197706 5/16 (31%)
I-set 3029..3120 CDD:254352
Ig 3057..3116 CDD:143165
I-set 3130..3220 CDD:254352
Ig 3148..3219 CDD:143165
I-set 3263..3354 CDD:254352
I-set 3401..3493 CDD:254352
Ig 3429..3490 CDD:143165
I-set 3539..3630 CDD:254352
Ig 3556..3625 CDD:143165
I-set 3676..3767 CDD:254352
IGc2 3690..3758 CDD:197706
I-set 3811..3900 CDD:254352
Ig 3828..3899 CDD:143165
I-set 3954..4046 CDD:254352
Ig 3963..4042 CDD:299845
I-set 4092..4180 CDD:254352
Ig 4102..4172 CDD:299845
I-set 4394..4483 CDD:254352
Ig 4411..4480 CDD:143165
I-set 4497..4581 CDD:254352
Ig 4519..4580 CDD:143165
I-set 4604..4693 CDD:254352
Ig 4621..4691 CDD:299845
I-set 4702..4792 CDD:254352
Ig 4702..4791 CDD:299845
COG4372 4996..>5260 CDD:226809
I-set 6536..6622 CDD:254352
Ig 6554..6622 CDD:143165
Ig 6654..6725 CDD:143165
I-set 6743..6829 CDD:254352
Ig 6760..6829 CDD:299845
I-set 6841..6928 CDD:254352
Ig 6858..6927 CDD:143165
I-set 6942..7033 CDD:254352
IGc2 6957..7023 CDD:197706
I-set 7066..7157 CDD:254352
Ig 7084..7153 CDD:143165
IGc2 7224..7289 CDD:197706
Ehrlichia_rpt 14571..15030 CDD:118064
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:254352
Ig 16858..16931 CDD:299845
I-set 16965..17060 CDD:254352
IGc2 16978..17050 CDD:197706
I-set 17068..17152 CDD:254352
Ig_2 17078..17152 CDD:290606
IG_like 17170..17253 CDD:214653
Ig 17180..17250 CDD:143165
I-set 17260..17342 CDD:254352
IGc2 17274..17331 CDD:197706
I-set 17347..17432 CDD:254352
IGc2 17367..17423 CDD:197706
I-set 17437..17521 CDD:254352
Ig <17468..17521 CDD:299845
I-set 17528..17611 CDD:254352
Ig 17553..17602 CDD:143165
I-set 17618..17708 CDD:254352
Ig 17635..17708 CDD:299845
FN3 17712..17791 CDD:238020
I-set 17813..17898 CDD:254352
Ig 17830..17894 CDD:143165
Ig 17922..17994 CDD:299845
FN3 17998..18090 CDD:238020
FN3 18098..18189 CDD:238020
FN3 18207..18298 CDD:238020
FN3 18307..18398 CDD:238020
CFPNP_001138724.1 TSP_1 81..132 CDD:306574
TSP_1 140..184 CDD:306574 4/10 (40%)
TSP1 196..255 CDD:214559 16/69 (23%)
TSP_1 261..312 CDD:306574 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.