DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sls and CFP

DIOPT Version :9

Sequence 1:	NP_001261304.1	Gene:	sls / 44013	FlyBaseID:	FBgn0086906	Length:	18468	Species:	Drosophila melanogaster
Sequence 2:	NP_001138724.1	Gene:	CFP / 5199	HGNCID:	8864	Length:	469	Species:	Homo sapiens

Alignment Length:	312	Identity:	60/312 - (19%)
Similarity:	88/312 - (28%)	Gaps:	105/312 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly  2697 CKATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPKEGRP---EAPEPTYETPVFIT 2758
            |....|..||..|..:......|.......|.|....|....|||.|.   .||||:.:.|
Human   174 CPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPP---- 234

  Fly  2759 HLNNIECKESDNVRFE---------CNVEPARDP---------TMSIEWFYNGQPLQAAAKFKSI 2805
                  .|....:.:|         |.|.....|         |..:     ||.::.......:
Human   235 ------GKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGL-----GQTMEQRTCNHPV 288

  Fly  2806 YDFG--YCALDLTNSYAENSGV--------------YTCKATNSK--------GSATTSGTL--- 2843
            ...|  :||.|.|.::..|:.|              ..|...|.|        |..:...|.
Human   289 PQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGR 353

  Fly  2844 -----KCTGGKTMFLDTQH------------------------PQGEAGLEAVQETEEELANRYT 2879
                 :|.|.:.   |.:|                        |.|.....|.|.....|..:|.
Human   354 KFDGHRCAGQQQ---DIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYP 415

  Fly  2880 SKTTKPETQYPPPV--WTKPLQ-------AEFHLSEAQP-IHLEANVEPKED 2921
            ...:..|.|....|  |.:||.       .:..:.|.:| :|:.|..:|:|:
Human   416 PTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEE 467

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sls	NP_001261304.1	I-set	87..174	CDD:254352
		Ig	109..175	CDD:143165
		Ig	254..334	CDD:299845
		I-set	255..344	CDD:254352
		I-set	372..462	CDD:254352
		Ig	390..463	CDD:299845
		Ig	471..561	CDD:299845
		I-set	471..560	CDD:254352
		I-set	618..709	CDD:254352
		Ig	645..705	CDD:143165
		DUF1136	715..741	CDD:284093
		IG_like	762..843	CDD:214653
		Ig	779..835	CDD:143165
		I-set	890..982	CDD:254352
		Ig	918..979	CDD:143165
		DUF1136	988..1014	CDD:284093
		I-set	1024..1116	CDD:254352
		Ig	1058..1113	CDD:143165
		I-set	1158..1250	CDD:254352
		Ig	1178..1246	CDD:143165
		DUF1136	1256..1282	CDD:284093
		I-set	1291..1380	CDD:254352
		IGc2	1304..1372	CDD:197706
		DUF1136	1388..1414	CDD:284093
		I-set	1424..1515	CDD:254352
		Ig	1442..1513	CDD:143165
		DUF1136	1522..1548	CDD:284093
		I-set	1558..1645	CDD:254352
		IGc2	1571..1639	CDD:197706
		DUF1136	1655..1679	CDD:284093
		I-set	1691..1782	CDD:254352
		IGc2	1718..1772	CDD:197706
		DUF1136	1788..1814	CDD:284093
		I-set	1824..1916	CDD:254352
		IGc2	1838..1906	CDD:197706
		DUF1136	1922..1948	CDD:284093
		I-set	1958..2049	CDD:254352
		Ig	1985..2044	CDD:143165
		I-set	2089..2181	CDD:254352
		IGc2	2103..2171	CDD:197706
		DUF1136	2187..2213	CDD:284093
		I-set	2222..2314	CDD:254352
		IGc2	2236..2304	CDD:197706
		DUF1136	2320..2346	CDD:284093
		I-set	2356..2448	CDD:254352
		Ig	2384..2445	CDD:143165
		DUF1136	2454..2480	CDD:284093
		I-set	2488..2580	CDD:254352
		Ig	2516..2576	CDD:143165
		I-set	2622..2714	CDD:254352	5/16 (31%)
		IGc2	2636..2704	CDD:197706	2/6 (33%)
		I-set	2754..2844	CDD:254352	21/139 (15%)
		Ig	2771..2840	CDD:143165	18/110 (16%)
		IGc2	2908..2974	CDD:197706	5/15 (33%)
		I-set	3029..3120	CDD:254352
		Ig	3057..3116	CDD:143165
		I-set	3130..3220	CDD:254352
		Ig	3148..3219	CDD:143165
		I-set	3263..3354	CDD:254352
		I-set	3401..3493	CDD:254352
		Ig	3429..3490	CDD:143165
		I-set	3539..3630	CDD:254352
		Ig	3556..3625	CDD:143165
		I-set	3676..3767	CDD:254352
IGc2	3690..3758	CDD:197706
I-set	3811..3900	CDD:254352
Ig	3828..3899	CDD:143165
I-set	3954..4046	CDD:254352
Ig	3963..4042	CDD:299845
I-set	4092..4180	CDD:254352
Ig	4102..4172	CDD:299845
I-set	4394..4483	CDD:254352
Ig	4411..4480	CDD:143165
I-set	4497..4581	CDD:254352
Ig	4519..4580	CDD:143165
I-set	4604..4693	CDD:254352
Ig	4621..4691	CDD:299845
I-set	4702..4792	CDD:254352
Ig	4702..4791	CDD:299845
COG4372	4996..>5260	CDD:226809
I-set	6536..6622	CDD:254352
Ig	6554..6622	CDD:143165
Ig	6654..6725	CDD:143165
I-set	6743..6829	CDD:254352
Ig	6760..6829	CDD:299845
I-set	6841..6928	CDD:254352
Ig	6858..6927	CDD:143165
I-set	6942..7033	CDD:254352
IGc2	6957..7023	CDD:197706
I-set	7066..7157	CDD:254352
Ig	7084..7153	CDD:143165
IGc2	7224..7289	CDD:197706
Ehrlichia_rpt	14571..15030	CDD:118064
SH3_p47phox_like	16753..16807	CDD:212790
I-set	16841..16931	CDD:254352
Ig	16858..16931	CDD:299845
I-set	16965..17060	CDD:254352
IGc2	16978..17050	CDD:197706
I-set	17068..17152	CDD:254352
Ig_2	17078..17152	CDD:290606
IG_like	17170..17253	CDD:214653
Ig	17180..17250	CDD:143165
I-set	17260..17342	CDD:254352
IGc2	17274..17331	CDD:197706
I-set	17347..17432	CDD:254352
IGc2	17367..17423	CDD:197706
I-set	17437..17521	CDD:254352
Ig	<17468..17521	CDD:299845
I-set	17528..17611	CDD:254352
Ig	17553..17602	CDD:143165
I-set	17618..17708	CDD:254352
Ig	17635..17708	CDD:299845
FN3	17712..17791	CDD:238020
I-set	17813..17898	CDD:254352
Ig	17830..17894	CDD:143165
Ig	17922..17994	CDD:299845
FN3	17998..18090	CDD:238020
FN3	18098..18189	CDD:238020
FN3	18207..18298	CDD:238020
FN3	18307..18398	CDD:238020
CFP	NP_001138724.1	TSP_1	81..132	CDD:306574
		TSP_1	140..184	CDD:306574	3/9 (33%)
		TSP1	196..255	CDD:214559	15/68 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	219..238		7/28 (25%)
		TSP_1	261..312	CDD:306574	11/55 (20%)
		Interaction with Compliment C3 beta chain. /evidence=ECO:0000269\|PubMed:28264884, ECO:0000269\|PubMed:31507604	351..359		0/7 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4475
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900