DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sls and ttn.1

Sequence 1:NP_001261304.1 Gene:sls FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:XP_021334746.1 Gene:ttn.1 ZFINID:ZDB-GENE-030616-413 Length:28035 Species:Danio rerio

Alignment Length:22631 Identity:4439/22632 (20%)
Similarity:7494/22632 (33%) Gaps:7447/22632 (33%)


  Fly    31 SQEQHQEQRISRTEQHVQRSQVTTQRQVQQHHGGSIGGAYVPPSLTHVYA------QGDISPPVF 89
            |:|....:..|...:||:.|  ..|||      |:|...  ..:::.:.|      .|..:.|.|
Zfish   485 SEEIESREDFSNVPEHVEMS--AQQRQ------GAIEAK--EETMSEISAVSEPVEAGAGAAPFF 539

  Fly    90 EQIFKNARFAQGGNALFEGRLRGNPKPFVTWTRKGAPLLESQKFRMSYNEATGDVSLLINQIGPG 154
            .:.....:..:|...:|:.::.|.|||.:.|.:.|.||....::|::||:.||...|.|:.....
Zfish   540 VKKPTVQKLVEGDRVVFDCQVGGTPKPHIYWKKSGIPLTTGYRYRVAYNKDTGACKLEISMTFAD 604

  Fly   155 DEGEYTCTARNQYGEAICSVYI--------------------------QPEGAPMPA-------- 185
            |.||||..|||..||:..|..:                          :|:.|.:||        
Zfish   605 DAGEYTVFARNPLGESSASAILLDEESYDQYVKKQEDHFKTEVPTIAEEPKVADVPAAFETVTEK 669

  Fly   186 ---------LQPIQNLEKNIYSNGYSYTSIEEEFRVDTFEYRLLREVSFREAITRRSGYEQDSQL 241
                     .|..|.::..|.......:|:|:.| :...|:.||: ::::|.:|     |...||
Zfish   670 DQLLMQRRMAQQTQMMQSFISEQELQMSSLEQRF-IQEVEFHLLK-ITYQELVT-----EDGEQL 727

  Fly   242 SQELDRNQGPAQAPQISQKPRSSKLIEGSDAVFTARVGSNPKPRLTWFHNGQRLVASQKYEIS-Y 305
            ...:..:.  |.:|..:...:..:|.||..|.|..|:...|.|::.|:.:|:|::...:|::. .
Zfish   728 DMSVPEHD--AVSPVFNTPVKGYRLREGMSATFHCRMSGTPLPKIVWYKDGKRIIHGGRYQMEVL 790

  Fly   306 SSGVATLRVKNATARDGGHYTLLAENLQGCVVSSAVLAVEPAA---------------------E 349
            ..|.|:||:....|.|...||.|..|::|..|||..|.||.|.                     .
Zfish   791 RDGRASLRLPTVLAEDEAVYTALISNIKGNAVSSGKLYVESAGVAQTQLSQPGAVQRIRSTSPRS 855

  Fly   350 TAYEP-----KPVDVMAE-QLEAGKALPPAFVKAFGDREITEGRMTRFDCRVTGNPYPEVFWLIN 408
            |:..|     :.:|...| |||  :...|.||:.....:.:||:..|||.:|.|.|.||.:|..|
Zfish   856 TSRSPGRSPSRRLDETDEAQLE--RLYKPVFVQKPSSVKCSEGQTARFDLKVVGRPMPETYWFHN 918

  Fly   409 GRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIEAQLNVLEKEQVVAPQF 473
            |:||.:|.:|||:|.|.|:.|:::.....||:|....:|:|:||:..:...|.|..||.:|.|||
Zfish   919 GQQVVNDYTHKIVVKEDGTQSMIVVPAMPLDSGEWTVVAQNRAGKTTVSMTLTVEAKENLVRPQF 983

  Fly   474 VQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDG--GATCLEIPRVTAN 536
            |::...::|:||..:.::..|||.|.|.|.|.|:...||......:.|:|  |....:||....:
Zfish   984 VEKLRNISVKEGTLVELAVKAIGNPLPDIVWLKNSDIISPHKHPHIRIEGGKGEANFKIPSSAGS 1048

  Fly   537 DAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVER 601
            |:.||..||.|.||....|.|:.|||...:|..| ::|.:|:.|  .:.:.|..||:..|     
Zfish  1049 DSAWYTATAINKAGRDTTRCRVNVEVDAVKPQPE-KKLVIPKGT--YKAKEIAAPELEPL----- 1105

  Fly   602 AKPHLRPGEED---------RVYPPPQFIIPLQNVQQTEGGRVHMEARIEPVGDPTMVVEWYLNG 657
               |||.|:|.         .....|.|...|.:|:....|..|.|.|:.|:|||||:|||..:|
Zfish  1106 ---HLRYGQEQWEDGDLYDKEKQQKPHFKKKLTSVRLKRFGPAHFECRLTPIGDPTMIVEWLHDG 1167

  Fly   658 RPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAILSVVQRPSIEQSSQNP 722
            :||||:.|...|.:||:.:||..:....|||...||.||..||.::.|.|.|....|:.:.:|.|
Zfish  1168 KPLAAANRLRMVNEFGYCSLDYEAAYSRDSGVITCRATNKFGVDQTSATLIVKDEKSLVEETQLP 1232

  Fly   723 NSL--QYINQLEDYSRYQRTESI--DEQLNQA-PQFI---RPLRDLGEFEEGKNVHFEAQVTPVN 779
            ...  |.|:::|..:.......:  |:.|.:. |:.:   .|:|.:    ||:...|..:||  .
Zfish  1233 EGRRGQRIDEIERIAHEGGPSGVTGDDNLEKTKPEIVLLPEPVRVM----EGETAKFRCRVT--G 1291

  Fly   780 DPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQSSIRVH 844
            .|:.:|.||.:||.|..|.|....|: |...|.|:..::.|:|...|.|.|  .|.:::..::. 
Zfish  1292 YPTPKVNWYLNGLLIRKSKRFRLQFD-GIHYLEIVDTKSYDSGDVKVSAEN--PEGVTEHVVKF- 1352

  Fly   845 SRSQVTADLGIPEQQRYIEKVEELEDYRKSQQRRHVQEAAEAIAPPQFKTPIQNQLDLREHAHAH 909
                               ::::.||:|...:|           .|:||.|.  ....:||....
Zfish  1353 -------------------EIQQKEDFRSILRR-----------APEFKAPA--PAPSQEHGRVS 1385

  Fly   910 FE-ARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRA-YNAMG 972
            || .:.|...|::...   |:...|:.:.|:  .|         ::||   ..|...|: :....
Zfish  1386 FEVVKAEKSADTSKEP---KEVVKLKKTERV--IH---------EKLT---EETEELRSKFKRRT 1433

  Fly   973 QDTTVAQLTVISKNEIVSESQHPGGLQKIQH--LEDSSRYG-----RREEEETYITQAPR----F 1026
            |:.....:|.:.......:..:.|.|:|.:.  |..:...|     ::|||.......|:    .
Zfish  1434 QEGYYEAITAVELKSRKKDESYEGMLKKRKEKLLHHTKELGPEAEKKKEEEAKLSISKPKPEKIV 1498

  Fly  1027 LGPLKGTTKILE---------GQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYV 1082
            |.|.....||:|         |...||..||..:.|  ...:|:.||..:..::|:..|:...:|
Zfish  1499 LSPSMEAPKIIERIQSQTVGLGDEVHFRCRVTGKPD--PECQWFKNGILLEKSDRVYWYWPEDHV 1561

  Fly  1083 A-LDISQVRAEDAGVYLVVARNKLGEAQQQATMIVETRSSIDTSSMHRGLYEKTQNLENKPFVEP 1146
            . |.|..|.|||:...:|.|.|.:||....|.::|:.:..:..          ||.||       
Zfish  1562 CELVIKNVLAEDSASVMVKAMNIVGETSSHAFLLVQGKQVVTF----------TQLLE------- 1609

  Fly  1147 QYDIEEISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYY 1211
                ::.:|.|...||               .||.   ..:|.::|:|..|...:..|.::|.:.
Zfish  1610 ----DQSAKEKDTMVT---------------FECE---TNEPFVKVKWMKNNAEIFSGDKYRMHS 1652

  Fly  1212 DFGFVALDIIKATAADSGEYTVRATNHLGTAHTSA----------CVRVIDHTDVVTET------ 1260
            |.....|.::..|..|..||:....:. ....|||          .|:.:::|: |.||      
Zfish  1653 DRKVHFLSVLIITMNDEAEYSCVVVDD-DQIRTSASLYVEGAPLEIVKNLENTE-VPETYSGEFE 1715

  Fly  1261 --------------QNEQSLEQIQLLEDSRRRHH-------QEED-------------------- 1284
                          :|::....::.:..:||..|       ::||                    
Zfish  1716 CVLSREDAEGTWYFENKEITPSLKYVVSARRGRHSLSVKDVKKEDQGKYTFKTGDLKTSASLKMK 1780

  Fly  1285 ---ITIMQAPQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFD 1346
               :|::|      ||.::...||....||.|.   ...::...|..||:.:...::....  .|
Zfish  1781 LRPVTLLQ------GLSDLTICEGDIAQLEVRF---SQENVEGSWMKNGQAISASNKIHMV--ID 1834

  Fly  1347 YVALDLL--GCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQNESGLQKIQYLEDSTR 1409
            .|...||  .....|.|:|:.....|          .|.....||::|..               
Zfish  1835 KVTHKLLIEDATKDDGGMYSFVVPAQ----------DISTNGKLIVQTIG--------------- 1874

  Fly  1410 HRRSEFVDEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFR 1474
                            ||| |....:|.||..|..|.||. .||.. .::||:|.:.:|...|.:
Zfish  1875 ----------------FLT-PLKDVSTVEGTKAVLEAKIS-ATDIT-SIKWFQNDKLVTASDRVQ 1920

  Fly  1475 PIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYLE 1539
            .:.......|.|....|.|.|.|     .||..   :|:..|:...:.|.:         |.::|
Zfish  1921 MVVKGSKQRLAINRTYASDEGQY-----KLIAG---KVDSTCKLSVEPVAI---------IKHME 1968

  Fly  1540 DRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGS 1604
            |                          ....|.|...||   :.||.|.:...|......||:|.
Zfish  1969 D--------------------------CVCTETQNVTFE---VEVSHPGIDALWTFKGQALKAGP 2004

  Fly  1605 RFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAVAVVHTKKSIYLESQHETALPRLQ 1669
            ::...:.....:|.:::.:.::.|.|                        :::..:.|:      
Zfish  2005 KYKIESKGTHYSLTVLNAMKDEEGEY------------------------VFMAGEKES------ 2039

  Fly  1670 HLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIE 1734
                   |.|:.|....:::      |:.||.|||:|....|..   |.:|....:||::|.|::
Zfish  2040 -------RARLIVSGGAINR------PLHDVTVAESQTSVLECE---VANPTTEGKWLKDGNPVD 2088

  Fly  1735 ASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIVQSKTSIQLETQHEAAMH 1799
            .|:...:.::.....|.:....|:|.|.||.:..|              ||||..|:.  ||.  
Zfish  2089 FSDNILSENNGAVRQLVIVITRPQDVGEYTYQVAN--------------SKTSGNLKV--EAV-- 2135

  Fly  1800 KIHQLEDHSRYQRREEEEYTVTTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNG 1864
            ||          |:..:..|||.....|..:....:.|:|.                  :|..||
Zfish  2136 KI----------RKTMKNQTVTETQEAVFSIELTHSDVKGS------------------QWIKNG 2172

  Fly  1865 KPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVLNVTSRSSIIHETQHE 1929
            ..:....:|..|.|.....|.|.....:|...|..:    ||:...:..|||             
Zfish  2173 VEIHPSDKFDITIDGMVHTLKIKNCNTQDESVYGFK----LGKLSANARLNV------------- 2220

  Fly  1930 EALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVNDPTMKVEWY 1994
            |.:..::..:|.:...                          ||....|.:|   :...:.|:|.
Zfish  2221 ETIKIVKKPKDVTSLL--------------------------GATASFELSL---SHDDIPVKWM 2256

  Fly  1995 CNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNVTANKTLDLDT 2059
            .|.:.:.|....|...:.....|.|....::..|.|:.    .||.  ..|:.:           
Zfish  2257 LNNQELTTSSNIKILSERKAHKLIIQSVESDLAGEYIA----VIGH--LQCSAH----------- 2304

  Fly  2060 LDAQRLEKIRQLETYAPPPKPVVEEKGQKPIFLTPLSNLEHLKEGEHAHLECRVEPINDPNLKIE 2124
            |..:.|...|                        ||.|:| :.|...|..||.|...|.|:   .
Zfish  2305 LQVEHLRVTR------------------------PLKNIE-VPETHVATFECEVSHFNVPS---A 2341

  Fly  2125 WFCNGKQLPTGHRYRTTHDFGYVA------LDILYVYGEDTG--TYICKATNQLGEAVNTCNVRV 2181
            |..||.::....:      ||.|.      |.::.|..||..  |:||      |....:.|:.|
Zfish  2342 WLKNGVEIEMSEK------FGIVVQGKIHQLKVMNVSQEDVSEYTFIC------GNDKVSANLTV 2394

  Fly  2182 LNRRSMILDTQHPDALEKIQKLESKVPNARTEVGDAPISPPHFTAELRGSTEIYEGQTAHFEAQV 2246
                ..||.|      ..:|.|.:|                             |..|..||.. 
Zfish  2395 ----KPILIT------SMLQDLNAK-----------------------------EKDTISFELN- 2419

  Fly  2247 APVHDPNLRIEFYHNGKPLPSASRFHI-TFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSST 2310
              |:...:..::..||..:.|:.|... |..|.: ||.|.:....|.|||...|    |.|.:|.
Zfish  2420 --VNYEGITYKWLKNGVEIRSSDRCQTRTKQFTH-SLTIRNVHFGDVGEYKFVA----GSAETSA 2477

  Fly  2311 NLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTRQRPVFTQPLQNIDRINEHQTAH 2375
            .|.|..|  :|..|:|.:.:                                    ::.|.:.|.
Zfish  2478 KLFVDAR--VIEFTKHIKDI------------------------------------KVTEKKKAT 2504

  Fly  2376 FEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEA 2440
            ||..|   .:||:.|.|.::.:.:|.|.|.....|.....|.|..:|..|.|.|...|    |.:
Zfish  2505 FECEL---SEPNVPVMWMKDGQELELSERFRATTDKFLQRLMIQTVRMSDAGEYSVVA----GAS 2562

  Fly  2441 VTTASMRVVSEASIQMDTQHPDSISRIHQLEKPLAPRPTEPERLFEKPIFTQLLTGPSELWEGTH 2505
            |:.|:: ||....:.:                      :||.   ||.|         .:.|...
Zfish  2563 VSKANL-VVEGKDVHI----------------------SEPA---EKDI---------TVVEKQR 2592

  Fly  2506 AHFEARVVPVGDPSLKFEWFINGVELQMGSR------LRTTHDFGFVTLDITAVVPEDAGVYMCR 2564
            |.||   ..|.:..:...|..||||:|...:      :|.||     .|.||.....|||.|   
Zfish  2593 ATFE---FEVNEDEIDGRWQKNGVEIQSFDQRFNYVTVRKTH-----RLTITETYRSDAGEY--- 2646

  Fly  2565 AYNAAGEAVSSTAMKVKTKSNIDGQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQAPVFTTHLQ 2629
                       |.:..|.:|.:.....|||                          ||....|:|
Zfish  2647 -----------TFIAGKNRSTVSLHVQIPE--------------------------APQIIRHMQ 2674

  Fly  2630 SYDKLHEGQHVLLEA------QVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLR 2688
            .         :.:||      .||....|..::.|:||..:|::|.:.:...:....||.:..:.
Zfish  2675 P---------LSVEAGKPARFSVEVTGIPQPQVSWYKNSQALSSGFKCKFQREGNEHTLLLIEVF 2730

  Fly  2689 ADDSAIYTCKATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPKEGRPEAPEPTYET 2753
            .:|:|.|.|:|.|..|.|.|::||.:|                 :.|:.:|:...|      ...
Zfish  2731 PEDAAQYNCEAKNDYGVATSSASLNVE-----------------VSEVVSPETVAP------VSA 2772

  Fly  2754 PVFITHLNNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFG-YCALDLTN 2817
            ||.||.|.:...:|.::.||:|.|.   ...:.|.|:...:.:..:..|: :..|| .|.||::.
Zfish  2773 PVIITSLQDTSVEEGESARFQCRVS---GDDLKITWYRRDKEIVMSDNFQ-MTQFGDTCQLDISR 2833

  Fly  2818 SYAENSGVYTCKATNSKGSAT-------------------------TSGTLKCTGGKTMFLDTQH 2857
            :|..::|.|||.|.||.|..:                         ||.|:..|...||      
Zfish  2834 AYVADAGEYTCVARNSGGMVSCSAVLTVNDHSVSTVASVSTHSEMVTSQTMTETRSSTM------ 2892

  Fly  2858 PQGEAGLEAVQETEEELANRYTSKTTKPETQYPPPVWTKPLQ---------AEFHLS-EAQPIHL 2912
             :....:..|..:...:.:....:.|..|.....||.|..:.         |:|:.| ..||   
Zfish  2893 -ESFESVSTVMMSSTSVKSIEVQQVTSEEEYSTSPVLTLKMSDVIVSLGDVAQFNCSFSGQP--- 2953

  Fly  2913 EANVEPKEDPNLFIE--WYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGE 2975
                        |.|  |..||:.:.:..|.:...|.|.:::.::.|:..|||.|.|...|:.||
Zfish  2954 ------------FTEIVWDHNGRTITNTERVQYAHEAGLISLIILNVHLGDQGSYCCTVKNRNGE 3006

  Fly  2976 AFTSTTIFCSSKENIIESTQHPKG---------AEGLEQIQDLE--DSLRKDG--------SKPE 3021
            :.||..:...:||...:.|..|..         :|..::..|.|  :||:..|        |...
Zfish  3007 SRTSAQLTVEAKEANPKETPVPSDSISKSAKTESESSKKATDQEKVESLQNVGALTTKWQISHHY 3071

  Fly  3022 QPDL----------GIPPRF----TTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVL 3072
            .||:          .|.|.|    :.||  :|...|.:..::    |..|..|..|.|.||...:
Zfish  3072 NPDVTTLLERDKYDAIQPEFLVKLSPEF--LAKQREIDSIYY----INKGSPSPFIVWLYNQLNV 3130

  Fly  3073 EASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGTAEISCNLE-----CVDKPRGQK--- 3129
            |........:......|.|.....|..|:.:|:..|..|....|.:|:     .||:....:   
Zfish  3131 EEPRSYSLKHDGPLCCLNVKNVNTEQGGSNSCKVINAAGDKTCSTHLKMKTVSTVDEEASYEEEA 3195

  Fly  3130 ---PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLD 3191
               |.|...|..:|. ..|....|||.:  ...|::..:|:..|..::.|::::.:|......|:
Zfish  3196 KVPPVFKKKICNMES-NIGNPVKFECEI--EETPNVTFKWFKAGSEIKQSDKVRIISRQTTSSLE 3257

  Fly  3192 ISYLQDHDSGEYVCRAWNKYGEDFTRTTLNCGGRGGVFYDSLQPDSLQRIRELECPQGQQADTSA 3256
            :......|||||.|||.||:|.|.....||.                                  
Zfish  3258 LPSPTKDDSGEYSCRASNKHGSDTCSAQLNI---------------------------------- 3288

  Fly  3257 PLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFR-TFHDFGI 3320
             ..:||.:|:.::.::: :...|....|.:.|  .|..|.|.||.:||:|...:|:. |..|...
Zfish  3289 -TASEPARFLRKLSNIS-IPMSQKLRLECKFT--GDRKLFVTWYKDGKQLYASYRYNTTVTDNSC 3349

  Fly  3321 VILDILYCYEENSGVYEARARNKYGEDVTRASLKCASKSSLILDSQLPRGMEGGLEKIANLEYSM 3385
            .:..:..|....:|:|.....|.:|.::..|::...::.:..            ::|:.:|    
Zfish  3350 TLESLQECDNTTTGIYSCEVSNAFGREICHATVTAVTEPARF------------VKKLTDL---- 3398

  Fly  3386 VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRF 3450
                              ::|:.  :.||      .|...|.|  |||.|.||.:|:.|.|..|:
Zfish  3399 ------------------SIPMS--QKLR------LECTFTGA--PKLFVTWYKDGKQLYASYRY 3435

  Fly  3451 RTFCDFGFVILE-ISPVYPEDSGEYSCRAINEYGEAVTTATMKIQGKRSIIMESQLPKGMEGTID 3514
            .|.......||| :.....|.:|.|||...|.||      |.|...:...:.|            
Zfish  3436 NTRVTANSCILECLHECNNETTGRYSCEISNIYG------TDKCDAQVVAVTE------------ 3482

  Fly  3515 RIAELEGLGSRSTEFVPDDDTGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGK 3579
                                   |..|:....||.|..:.....||..  ...|.:.|.|:.:||
Zfish  3483 -----------------------PARFVKKLTDMSIPMSQKLRLECTF--TGAPKLFVTWYKDGK 3522

  Fly  3580 ALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQVKGRQGIVMEPQLPS 3644
            .|:|..|                        |..|.|:.      ||.|                
Zfish  3523 QLYASYR------------------------YNTKVTSN------SCIL---------------- 3541

  Fly  3645 NFRTGTESLQKLEETMHKREELVTEDEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMR 3709
                                                                :|           
Zfish  3542 ----------------------------------------------------EC----------- 3543

  Fly  3710 IEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTSAKVTCKGKHNI 3774
                           :|:.|:             ..:|.|:|..:|.:||....|:|..      
Zfish  3544 ---------------LHECNN-------------ETTGRYSCEVSNIYGTDKCHAQVVA------ 3574

  Fly  3775 VYESQLPEGMTSEKLKELERGRIPEAPKVVEEVFGPPKFTTQITSVTVDEAEAVRFECQVEPKTD 3839
                                            |..|.:|..::|.|.:...:.:|.||.....  
Zfish  3575 --------------------------------VTEPARFVKKLTDVAIPVTQKLRLECTFTGA-- 3605

  Fly  3840 PSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDS-GEYVCRAINNYGEDRTRATVSCK 3903
            |.:.|.||::||.|.:.:||..........|:.|:...:.: |:|.|...|:.|.|      .| 
Zfish  3606 PKIFVTWYKDGKQLYASYRYNTKVIGDTCILECLHECNDATPGKYSCEVSNSIGTD------IC- 3663

  Fly  3904 KLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTE 3968
                                    .|.|..:|                :|.||..::|::    :
Zfish  3664 ------------------------HANITTFT----------------EPARFELKLKDK----Q 3684

  Fly  3969 MAVT---KFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMN------FGWVYPEDS 4024
            :|::   |.||..  .|.|.:.|.|:.:||.|....|:...     |..|      ......|..
Zfish  3685 VAMSKNLKLECTF--TGAPKIFVTWYKDGKQLYASYRYNTT-----VVGNTCTLECLHECTKETP 3742

  Fly  4025 GEYVCRATNLYGKDETRA-IIKVSGKPGIVYDSQLPAHMQSIDRIREMEASWQVVPDEVDPDAKP 4088
            |:|.|..:|.||||...| :...||          ||.                           
Zfish  3743 GKYSCEVSNSYGKDICHAEVTTFSG----------PAR--------------------------- 3770

  Fly  4089 RTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDGMFHLDVPKT 4153
                 ||..|..|::::|...|......|..:..|.|..:|.......|.               
Zfish  3771 -----FVKTLTDQSLQQGQKLRLEASFKGIGKIFVTWYKDGKQAYASYRC--------------- 3815

  Fly  4154 RQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLKNSPRPWYDYELAAYQKERQENELEKV 4218
                  ..:||....|.|                                  |..|..||...|.
Zfish  3816 ------NTKVIGNTCVLE----------------------------------YLHECDENTPGKY 3840

  Fly  4219 FDERKQVLSEQSSHTLKGVEHLKPKQYKPPTPDWQQNVKAKKSEDYYNKLQTLETEQLLKETNLR 4283
            ..|   |::|..|                               |..:.|.||.||:.:      
Zfish  3841 SCE---VMNEDGS-------------------------------DICHALVTLGTERKI------ 3865

  Fly  4284 RDTHQYAIPGEKVVSSSQAKGMAQSYEENLQEKTSTTEVQAAPPKGIAQPSESSVHGREVHMNKQ 4348
                                                      ||....:|||        |:   
Zfish  3866 ------------------------------------------PPTFTKKPSE--------HI--- 3877

  Fly  4349 QQVQKEIQGDLEITRKITATETTEVEHKGTIQERVVQGPVKPAKAPVFTKKIQPCRVFENEQAKF 4413
                ::.:|.|                                                   .|.
Zfish  3878 ----EDAEGKL---------------------------------------------------VKL 3887

  Fly  4414 EVEFEGEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGGTAKCS 4478
            |....|....:|.||:::..|..|....:...|..:::.:|:..|.||.|::|.|.|..|||...
Zfish  3888 ESRVSGSQPLSVIWYKDNKEINTSDIYDVSFKSNVAVMCLRKATVTDSGVYTCSASNEAGTASFQ 3952

  Fly  4479 ANLVVEERRRAGKGGIQPPSFVTTIQSTTVATGQLARFDAKVTGTRPLDVYWLKNGMKIQPSIKF 4543
            ..:.:.|::|       ||:|...::..||:.|:.......|.|:.|:.:.|:|:..::..|...
Zfish  3953 VVVNITEQKR-------PPTFDIPLKPMTVSEGERLNLSCHVCGSPPVKIQWMKDRREVTSSAST 4010

  Fly  4544 KMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAG------EARCDGDCIVQSPSKPEKPTTP-GSE 4601
            ||...|...||.|.:....|:|.|.|.|.|.||      :........|...:.|..|||| .::
Zfish  4011 KMTFVDGTATLEINQASKTDAGDYLCKATNNAGSEFSKTKVTIKDKAGVAPAAAPAAPTTPQATK 4075

  Fly  4602 KAPHI--VEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMS--------RQG 4656
            |..::  :|:.||..:.|.....|..:|.|.|.|..:||:|       ::.||:        ::|
Zfish  4076 KLDNLFFIEEPKSIHIVEKGTATFIAKVGGDPIPNVKWMKG-------KWRQMTHGGRINIQQKG 4133

  Fly  4657 EYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITALKDVSVTEGMPAQF 4721
            :..:|.|.|....|.|.|:|||.||.|.|:.|..|.|.  |..::.|.:..||            
Zfish  4134 QESKLEIKEVTKSDSGQYRCVASNKHGEIECSTDLNVD--EKKESGPEVVKLK------------ 4184

  Fly  4722 KTTVTGKVKATSVQWFREGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVTSSTG--QV 4784
                                   :||..|             .:.:||..|..|.:..:..  :.
Zfish  4185 -----------------------KTPSKQ-------------KSPKEDKDIDIVELLRNVDPKEY 4213

  Fly  4785 ESSAKLTVKKRRISAFQ--LRTIDSAEDESSSSGREDSAPESPHAFQPGQQPGQQFGQFLGVNGQ 4847
            |..|::    ..|:.|:  |:.|:..:.|   .|.|...||.          .:...:.:     
Zfish  4214 EKYARM----YGITDFRGLLQAIEFLKKE---KGEESGRPEE----------DEDLAKLV----- 4256

  Fly  4848 GQHQGRSRQKKPKVRSKSLQPATKVIPWRKSSRPTRGRSLDK-GVFLPGFK---PEPVKSWTEET 4908
            ...|.|....:|....|.:...|              ..|:| .||....|   ||...:|.::|
Zfish  4257 SDLQRRMENSEPVTLLKDITDQT--------------TQLNKEAVFECEIKVNYPEITLAWYKDT 4307

  Fly  4909 INLKATPIEKKKPAPKLEAAKVVLKSIKT--ERDQGIMSLGATLEQIIAGKTEKEAIPWITMREK 4971
            ..|:.    ..|...||...:.:|| ||.  ..|||..       :::.|       |.|: ..:
Zfish  4308 QKLET----NDKYDIKLVGDRQILK-IKNCQTSDQGNY-------RVVCG-------PHIS-SAR 4352

  Fly  4972 LKAVESVQQQLNKFDLDEVYLQPLEGQIETEGQLPQQAQVEQVQRTKEIQRLKSMESVEIMEMTD 5036
            |..:|| |.::.|                     |..|  :|:|.||.||.:             
Zfish  4353 LTVLES-QDRVQK---------------------PSPA--DQIQFTKRIQNI------------- 4380

  Fly  5037 QIDKLITQQQNA---------KDLIPWKEMRQQLKSVQRVTKQIDKFKIEEVELRHLQAQQAITE 5092
                ::.::|:|         ..::.|.:...:||...:.|     ||.|  ..||....:.:|.
Zfish  4381 ----VVNERQSATFECELSFDNAVVTWYKDAWELKESLKYT-----FKCE--GRRHFMIIRNVTA 4434

  Fly  5093 EYQ-----------TGTAEETVVMIDESSKGSISKVLRR-----DEQLQYEDQSNIYKQKFITTE 5141
            :.:           .|..:.|..:.   ..|...::..|     |..:...|.|::...|..::|
Zfish  4435 DDEGVYSVIARLEPVGETKSTAELY---LSGKEFEIRTRSFDVPDTSIHVPDVSSVISLKDESSE 4496

  Fly  5142 DVNIMHVSER-EKLEAQRLIREQQAVNWR---QQQQRPQLQPLTSVEDTVISQTSERQKLVQQQS 5202
                .|..|. |..|.|....::::|.:.   |:.::|       :|:||..:..||        
Zfish  4497 ----FHYEETFETTECQNWTFQEESVTYASSLQEMKKP-------IEETVTKRVVER-------- 4542

  Fly  5203 FIEEAQRQQFVQVEDSQMMSLEEYEHQKIINQRTQQEAFSWRQPREPQKFIQVEDSTLLHLQERH 5267
             .|||.:|        .||..||......:            :|..|:|..:|:..    ::|:.
Zfish  4543 -TEEAPKQ--------VMMEAEEKPETTFV------------KPTVPEKEPEVKKP----VEEKV 4582

  Fly  5268 DT-----QEQQLLQQQPVMWDRGRKKPDQPQYVQPQEQRVKEEFVEKPKTYEEMHDELVEPTPIE 5327
            .|     |::|..||:|           :||.....:..|.|...| ||:         ||..:.
Zfish  4583 STVKVTEQKEQPTQQEP-----------KPQMTAEPKASVTESKPE-PKS---------EPKALP 4626

  Fly  5328 QPQPVPVMWERGKKKPQPQEKTFEEAHDELVEPTPVQQPEPVPVMWERGKKKVAQQETVLSQEVV 5392
            |||..|        ||:|             :.||  :|||.|                      
Zfish  4627 QPQSEP--------KPEP-------------KATP--KPEPKP---------------------- 4646

  Fly  5393 QTSQVVEQQIVEETKKTAVRRVIPPREPEQKVEQVTLKPTPRPRPKEAVKAEEIQLKP---LRST 5454
                        |.|.|.        :||.|.|   |||.|:|....:||..|:..||   |:|:
Zfish  4647 ------------EPKATP--------KPEPKPE---LKPEPKPAFAPSVKVPEVPKKPEVALQSS 4688

  Fly  5455 RPVPQPVEAEQK---AYEEATDELTEEPIPQPQPVMWERGKKKPQKPQEEVTEIPKTLEIAVDTL 5516
            ..:.:.|....|   |..:|..|:.|..|||      |:..:||| |.....|.||. |::...|
Zfish  4689 LAIKKDVALTAKPDTAQIKALVEMKEIEIPQ------EKLDRKPQ-PAVVAAEPPKK-EVSGLIL 4745

  Fly  5517 EEEV------------------PKPTEPQP--QPVLWARGQ------KKPQKPDEQKQELPKSLE 5555
            .|.:                  ||||.|:|  |.|:.:..:      :||...:..|:|..:.:|
Zfish  4746 NESIKDNSSILYESSSVQPASRPKPTLPEPVKQEVMTSSPEAKIEPTRKPPTQEVSKEEPARMVE 4810

  Fly  5556 IAVDTIEEDLIKPVQPEPQPVLWERKKKKPQPQDVIEEKLDVAPTKTYEKAVDVLPDEPKVE-EK 5619
            .:..|.|... |.|.|:.:|.....:.|...|:.|:|.|..|.|::  :|.|    .:.|:| |.
Zfish  4811 PSSKTSELPK-KQVTPKSEPTPKISEPKPAHPEKVVEVKAAVQPSE--KKPV----TKAKMETEM 4868

  Fly  5620 PEPVLWQRGKKKIPKSEPTEEVHP--------------DEVDAQIETVVKEDEMIVEEKRRIKKT 5670
            |...::...:|||.:...|.||..              :::.:|:|.:....|.:|:.......|
Zfish  4869 PPAKVFSASEKKIDQIPCTVEVTKKTCMEERLLKEGIVEDMPSQLEDLFFHHEHVVKVDASHHST 4933

  Fly  5671 KRPKSTKEVTEELFEEQPEEEISPEEEVPQKEVI--EEIEEIVEEKRRLKKTKKPKLTQQVTEEE 5733
            :.|.....:.|....::||         |..|:|  |||.|:.:.|:.:...||.:..:..|.|.
Zfish  4934 ESPSDNLRIVETELRQKPE---------PSFELIKTEEISEMKQTKQEILIEKKERKLETSTIET 4989

  Fly  5734 TPHEEIIKESEEVVQEQEEIVEEKKKVKKVKKPKTVAEKQLKEE------EIPTEETVEE----- 5787
            :| |.::|.:.:...::.:.|.:|||:.|....:.:.:...||.      |:..:|.|.|     
Zfish  4990 SP-ETVVKPNIKAPLKKHDTVADKKKMAKNVSLQNIDDSPRKEMAIQREIEVHMQEYVHENKRYQ 5053

  Fly  5788 EETAEDQQLVV--EESKKVKKVKKPTGTVEKTD-VEELPGEEVPV-EEVPVEEVPED------VA 5842
            |||.:...:|:  |...|:|:.:......|||. |.||..|.|.. :|..:...||.      ||
Zfish  5054 EETPQTSPVVMPKETETKLKEERNALERDEKTQAVSELVSEVVSAKKESEIVRKPEPDVLKPAVA 5118

  Fly  5843 PEEE--LIEEQEEIVDQDEIQEQKRKVKKAKKPKKTIEKTEIEIEEDQPEEEVLQEEIIGEQEEI 5905
            |.|:  .:.::|.||::....|..:....:|:|  |:|||.:. ||.:|...:::::||...:|.
Zfish  5119 PVEQNTSLPQKEPIVERKPSPEAPKPSVASKEP--TVEKTSVP-EESKPTVALVEKKIISPPKEP 5180

  Fly  5906 TERQRKVKSIKKPKKV-VTEKTVDQTEQPEKPEESQAEEVKETVTEEPKKPKP-----APEEAKV 5964
            ...::......||... |.:|....|:..:.|..:.....|||.:......|.     ..|:.|:
Zfish  5181 AVEKKPSPEAPKPTATPVEQKVSPPTDAGKGPVSAPGPAPKETTSTTQALLKQQSKIHIQEDGKI 5245

  Fly  5965 EQV----------------EKISLKPAPRKQRLLPEKEQVEEVLLKPVKK--IVA----VSEAEQ 6007
            |..                :.||||.|.:.....|..|  ||.||:.|||  |||    .|||..
Zfish  5246 EMATLKKVTKRSKEHQEDRDLISLKKAIKIHHEEPSTE--EEALLRNVKKAEIVADEMKYSEAVT 5308

  Fly  6008 PETPETEFEVKE--FAITTTEDILDVTKKRVKKKKPKTKVAAEESTEEPAEETEEF--EEEATQP 6068
            .....:.:||.|  ::..|:.:...::|...|||:.|.....:|.|.|...:.::|  ::|...|
Zfish  5309 EVKLSSSYEVTEDTWSYETSTEAEKLSKCEEKKKEYKDVREKKEMTLEMGVKEDKFKSKKETKIP 5373

  Fly  6069 EEVQPVEEIPEEPQVKEV-----ADERKTAPKPKPRKEEIIEKVEEVALKRVTRPKKELPQEATI 6128
            :|.:|  ||| :|.:|:|     |::.|.|.|.||     :||.:    |.|..|:|:...:.:.
Zfish  5374 KEKEP--EIP-QPTLKKVIRSIPAEKEKEAVKLKP-----VEKPD----KAVAGPQKDSNIDRSK 5426

  Fly  6129 EEVRLKPTQRTSIKPEEVKLEEVDLQHVEKK------------EDEIVQEEKRKTRKVKK-PKHE 6180
            :.:.::..:|. :|.|.:..:::::...::|            :|||.:|..:..:|.:. |..:
Zfish  5427 DSIGVQKHERL-LKDEPLSKKKIEVAATDQKAEESVMPKLSVAKDEISEEPMKFPKKGRGIPPQD 5490

  Fly  6181 DLPEIPDAEPTQLEEAEHIELEKQPKPEEDQPQVPWKRGEKKQPVEEVLE---EKKWPSGKRRPL 6242
            ..||....:|...|...::..||  .|.|.:.::..|:.||..|.:::.|   :.|.| ||...|
Zfish  5491 QKPETFTLKPFSKESQANVTAEK--VPNEQKEKIDDKQLEKLVPHQKLKEPHIQVKEP-GKSDKL 5552

  Fly  6243 PEQQPEEVQLKPIPSKPIEEQQKPEKAIPGPQLVPEEKPESEEEELELEPLKLPEDKKPKEPKAK 6307
            .|:..:..||:|      ..:..|.|::..|:...:|.|:.||:|:..:...:|.||..||..:.
Zfish  5553 KEETEKIKQLEP------PHEYLPMKSMSTPEKTTQEGPKEEEKEMIKKHGSIPVDKAKKEEVSL 5611

  Fly  6308 K-------EKKKKPKLKKATPSVDEVSEEVAEPFDEP-IAEEDEVEEMPVDDVKVVAVSEDVLPE 6364
            |       ||...||:.|.:|.|..:.::.....|:| ::::..|....::|.|.:.:       
Zfish  5612 KPVEGRTAEKTPSPKVDKPSPQVTSLIKKSPRSDDKPEMSKKIGVTPKKMEDKKEILL------- 5669

  Fly  6365 EEVVPTEETPEAKQKAHKKRTKRLKEASVEGQPQLLEAAIAEIEKVDEISQEISQK---TITLLK 6426
             :.|..::||..|.:..|              |:..|....|.:...::.|:.|.|   ...:||
Zfish  5670 -KPVELKKTPSPKAEISK--------------PKPTEKIAMERKSSAKLPQKTSPKDSVESVILK 5719

  Fly  6427 KTEDTRPQFITTEQLIELDVEDVRRDLEMKVTSNIIKKEKRR--VVLDDSQPLPELELI-TQKRI 6488
            |.    |:.::.::             |..:....:|..|.:  ||.:.|..:.||:.| ||:  
Zfish  5720 KV----PKAVSPKE-------------EKTINEPPLKTNKGKVPVVKELSPSVLELQKIPTQQ-- 5765

  Fly  6489 QEGIDKVADEELI--EDQQLIQNQQETT-----------------------TSEVIGQERKLVKK 6528
                     ||::  .:|....|::|.|                       ..|..|...|...|
Zfish  5766 ---------EEVVYEHEQDAEDNEEEETWGWELTPQDSYGSETYDDILEDGVVETPGMGDKKDGK 5821

  Fly  6529 KKKEIKPPRITEKLRPRQCVP---------------------EEP-------------------- 6552
            .|:|..|.| ...||||| .|                     |.|                    
Zfish  5822 PKEEPAPGR-GRGLRPRQ-TPSPGDAGRGRGKPGGGGDKPPGESPFGFQLKAVPLKFVKELQDIV 5884

  Fly  6553 ----------TVLECKVEGVPFPEI-KWYFNDILLFASEKYEITVMEQVAKLKIAKVTPSDVGVY 6606
                      .|.||::.  |...| .|..:...:..|.|::.|...:..||:|..|..||.|.|
Zfish  5885 LQEAESIGSSAVFECQIS--PSTAITTWMKDGSNIRESPKHKFTSDGKDRKLQIIDVQLSDTGEY 5947

  Fly  6607 TCEAKNEAGVATSRTNIILEKEQGVPPQFTKPLKIE-FIEEKQPERLKVTVTCQVTGKPNPEVKW 6670
            ||.||......||...:::|:   :|.:|||.|:.| .:.:.||    :.:||:::  .:.:|.|
Zfish  5948 TCVAKLGNKEKTSTAKLVVEE---LPVKFTKNLEEETSVLKGQP----MYLTCELS--KDKDVVW 6003

  Fly  6671 YRGIEEV--IPSE------------TVQMFYDEKTGDVALEVINPTPNEAVVYSVQAQNQFGRAI 6721
            .:..:|:  ||.:            |:|...|:..|               ||:.:.:|    ..
Zfish  6004 KKNGKELKEIPGKIQINIIGLQRAVTIQDMNDDDAG---------------VYTCECEN----IK 6049

  Fly  6722 GNANILSRVDEVPREILKAPT----VTPLSAVVVPTGGTLFFEAKYDGLPRPEVKWMRNGREIIE 6782
            ...|:  :|.|:.|:.|..|.    |.|.|.....  |.||.|.       |..||.: |.:.|.
Zfish  6050 TETNV--KVIEIVRDWLVKPLRDQHVKPKSTATFK--GELFKET-------PNWKWYK-GNDEIP 6102

  Fly  6783 NEETIIETTETTTTIKVVNMTRKR-----TGKYEVWAKNKVGEAKSSGSVVVSDQKPDEQIKPPR 6842
            ||.|  :.||.....|.:.:|.|.     ..:|.|..:.:...||     :...::..|.:||..
Zfish  6103 NEPT--DKTEVKKEGKEITLTIKNAQPDDVAEYAVEVEGRRYAAK-----LTLGEREAEILKPLA 6160

  Fly  6843 FIQPLEPKYFGEHEVAIIEAIVESEPLSSFQWFVHNEPIKSSNEVRIVSQANKSTLLIENFQSKF 6907
            .::.:| |.....|..|.|..|..|      |.:..:.:..|....|.|:..|..|.|:|.|...
Zfish  6161 SVEVVE-KTEANFETEISEDDVPGE------WKLQGQVLTRSPTCDIRSEGTKRFLTIKNVQLDQ 6218

  Fly  6908 VGPFTCRAENVGGSVTSTATVNLIPQEEAEEFESPRFVEELVQPVEVMDGEALLLTCQVTGKPTP 6972
            .|..|.:|.|   :||| |.:|:  :|...||..|      ::.|.|.:.:.......: .|...
Zfish  6219 AGEVTYQALN---AVTS-AMLNV--KELEMEFTVP------LKDVTVHEKKQAKFESTI-NKDVS 6270

  Fly  6973 KVEWYHNAEKITE-NKETTISQDLQGVCQLQITEVFPENEGQYECVATNKIGKSVSKTNVKIQAF 7036
            ||.|:..::.||: ||...|....:.:  |.|.....|:||:|   :...:||| ||..:.::..
Zfish  6271 KVIWFKGSDIITQGNKYEIIDDGKKHI--LIINNCAFEDEGEY---SIEVLGKS-SKAKMIVEGM 6329

  Fly  7037 EYIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPEKIEPKEGEQAKLEVKVVGKPKPKVKWL 7101
            .....|.:..||                             .|||:.|..|:::..:..| |.|.
Zfish  6330 RLNFTSTLKDLT-----------------------------VKEGKTAVFELELSHENVP-VTWY 6364

  Fly  7102 RDDEQIFASEEYQIENFEDGTSV------LVINHVYPDDLGTISFEAYNPLGVAVTTALFAVEVK 7160
            :::.::..|...       .|||      |.|..|..||...|..||   .|:..|..|..:|..
Zfish  6365 KNEIKVHPSRTV-------FTSVVGKKHTLEIKEVSLDDTCQIKAEA---KGIFTTANLLVIEGD 6419

  Fly  7161 FFFRCLELHYLCFPNSLESSIVGSKDYRKPEWVSQMEEMQVALKAAKCSPSLLNEMRDCRAALGE 7225
            .||.                 |..:||      :.:|:.:|..              ||..:   
Zfish  6420 AFFS-----------------VKLQDY------TAVEKDEVTF--------------DCELS--- 6444

  Fly  7226 TAKFSIQFAGNPIPDIQWYFNNVQLRASEKYRMVVQEQEATLEIMKITSEDCGYYNC-------- 7282
                      ..:| ::|:.|.::::||:...:.|:.:...|.:.|:.::|.|.|.|        
Zfish  6445 ----------RDVP-VKWFHNEIEIKASKMVTIKVEGKRRILNLKKVENKDKGVYVCDCGTDKTS 6498

  Fly  7283 ----------KLINEI-GMTM---TRAKFDIS-STSTIVEETKAKTTVKKKSGKKTMVKRSGASE 7332
                      |::..| |:.:   ..|:|::. |...:..:.|.|..|...|....::: .||..
Zfish  6499 SNLNIEARDIKVVKPIYGVELFDGETARFEVEISEDDVHGQWKLKGDVLSASPDVEIIE-DGAKH 6562

  Fly  7333 SQNVQKTEIRIIPTSAVETSMNVIKVKQPVSVLVEKSEISEVLVVKDREVADAEE---------- 7387
            :..:....:    :.:.|.:......|...::.|::..||.|:.:.|.:|.:.:|          
Zfish  6563 TLTLYNCRV----SQSGEVTFQGANAKCSANLKVKELPISFVMPLSDVQVYEKDEARFEIELSRE 6623

  Fly  7388 -------RSSQLIEEIEEEEEIEEKVQH-------DEEDEVEVQVEQKETYTSSK------KIEI 7432
                   :.||.::..|:.|.:.|..:|       ..|||.:...|.::..||:|      ::|.
Zfish  6624 AKTVRWLKGSQELKVDEKFEILAEGKRHILVVKSVAYEDEAKYMFEAEDKRTSAKLVIQGIRLEF 6688

  Fly  7433 TKTVELIRTKISEKIITIEDVQVLSHHE-EVQWLLESIEAESFGQIGESALRDLATIGLLLRYGC 7496
            .:.::.:..|..|   |.|....|||.: :|.|....:.......:..|                
Zfish  6689 VRPIKDVTVKERE---TAEFSIELSHEKIQVTWYKNDVRLHPSKVVHMS---------------- 6734

  Fly  7497 EHYEITYMYEQNIFI---SLKKPES--QSALVQLVEREGHEELISQILSESSNE-DETILAATVG 7555
            ||.:|..:..:.:.|   ||.|.|:  :::...|...||.....:::...::.| ||.:|...|.
Zfish  6735 EHGKIHTLSFKEVSIDDTSLIKVEALGKTSEAMLTVLEGEPYFTTKLQDYTAVEKDEVVLMCEVS 6799

  Fly  7556 FKAFIRMIQTYEITIEIVIRKFVREDFISQDWKICGKERIVETSQIIESHEAITHVKIEETFVEE 7620
            ..:  ..::.::.|.||...|.|   .|..|    ||:||            :|..|.|:..:.|
Zfish  6800 KSS--AQVKWFKDTNEITPSKNV---LIKAD----GKKRI------------LTVKKAEKGNIGE 6843

  Fly  7621 RTIIVQEETATTKVEKLFKKQEQEHVQNLEQQEQVKIQVQTKQIAQMNTKIKKHKKHKQQEQEVS 7685
            .......:....|:             |:|::: :||......:....|:..:.      |.|:|
Zfish  6844 YVCDCGSDKTAAKL-------------NIEERD-IKISRPLYSVEVTETETARF------ETEIS 6888

  Fly  7686 ETTIQCEQKETLAHETSAELPQSETLEQIEESLSTYETLPIQNLSKDTLQTVAVSVTTELSTPSP 7750
            |..:....|  |..:...:.|..|..|:     .|...|.:.|:..|....|..|.....||   
Zfish  6889 EEDVHGHWK--LKGDALHQSPDCEIKEE-----GTKHMLILYNVRMDMAGAVDFSAANAKST--- 6943

  Fly  7751 TASRVQEEIL----PQKVLAI------------NEEVLPLDEF-GLRKESPRPKENKLTENIEVR 7798
            ...||:...:    |.:.:.:            :.|.:|::.| |..|..|   .:::....|.|
Zfish  6944 AQLRVKARTIGLLRPLRDVTVTAGETATFDCELSYEDIPVEWFVGSTKMEP---SDRVVTRAEGR 7005

  Fly  7799 LKHALNVSHAKTAESSKELPSKIPKSVKAQRK--MKESRSLVVEAPNAEEAIEDLKPLKAVSQEV 7861
            | |:|.:......|:.:         ||...|  :.:::..|.|.|     :|..|||:..:.|.
Zfish  7006 L-HSLTLRDVIMTEAGE---------VKLTAKDFVTQAKLTVNEPP-----VEFSKPLEDQTVEE 7055

  Fly  7862 QSDILFSHEITEEQHQALETIEKLKPTSAIEDTVQQKLLSQEELIIAEVLPSETVGRDVTDVRPP 7926
            ::..:...|::.|:    ..::..:....|..|.:.:::::              ||    :|  
Zfish  7056 EATAILECELSREK----ADVKWFRDGQEIRKTKKHEMVAE--------------GR----IR-- 7096

  Fly  7927 GETISPRLTPNMSLCITECQPEDSIGEMQQAAKERMETPSMSVTESKAVGGQELEVLENVDHMPL 7991
                        .|.|.:|..:||            :|.:....|.|.      ....||:  |.
Zfish  7097 ------------RLIIKDCSLDDS------------KTYTCDAKEFKT------SAFLNVE--PP 7129

  Fly  7992 ITQPTKGLADYTIKAEEVPVQVQEIITFD-SLERETVAKTQTAKSNALELFELSEGLVSSTADSH 8055
            ..:.:|.|.|       |.|:.:|...|: .:.||: ||.:..|..|    |:.:|      ..:
Zfish  7130 FVEFSKPLHD-------VEVKEKESAKFECEVSRES-AKVRWFKDGA----EIRKG------KKY 7176

  Fly  8056 SPIAEDLP---IFEKDVKEATIDMQMQHHVTTSE---TVSNENA--VKDLKAVDTPKMAEGTLGQ 8112
            ..||:.|.   |..|.|.:...:.:.....:.|.   ||..|.|  .|:|..|      |||   
Zfish  7177 EIIAKGLQRILIISKAVFDDEAEYECDARTSKSSGMLTVVEEEARFTKNLANV------EGT--- 7232

  Fly  8113 SSALTIGETQQMNLVETTVELIEPNVEST-------KPAKGALTEAYGTAESNEETLLESLGLVP 8170
                   ||..:.:|   .|:.:|:.|.|       .|..|    .|......::.:|....|..
Zfish  7233 -------ETDSIKMV---CEVSKPSAEVTWHKGDQEIPEGG----RYEHVADGKKRILIIQDLRM 7283

  Fly  8171 DDNRKIE--------QGKVNISE--GEYVAKVQT-TTVTDTEGEFVSVAPK-------------- 8210
            ||..:..        .|.:.|||  .|::|:.|. .||...:.|||....|              
Zfish  7284 DDAGEYHCKLPASETTGTLKISELAAEFIARPQNQETVEGEKAEFVCSVSKDNYEVKWFKGDKEL 7348

  Fly  8211 LVNPKFDFV---EQSALQIKQDTTVEKEEILSSNIELAPQLATSNMFPAE-------LKVTSIYE 8265
            ..:.|::.|   ::.||.|| :..::.|...::||  ....|::|:...|       ||.|.:.|
Zfish  7349 TTDDKYEIVVDGKRRALIIK-NCELKDEGAFTANI--GSVKASANLLVIEKLRIITPLKDTQVKE 7410

  Fly  8266 VQPGLTSSDIITEQTKS--VSANQVFETMSIGVTSKPDMLESTSHIDAFQHPEFKTGDTILDENQ 8328
            .|..:.:.::.:|..|:  :..|:.....|..|.::.|.:.|. .|.|.:..: :...||...||
Zfish  7411 GQEIVLNCEVNSEGAKAKWLKNNETMFESSKFVMAQRDTVFSL-RIKAAEKSD-EASYTITLTNQ 7473

  Fly  8329 QPLEV---TNVQITESSTDIIDVLPNQKLTKAETVTDGFKYAEGLVVLP-----MESTIDK---- 8381
            :..:.   .|:.:.|.:..||:.|.:.::.:.:|:|...|.....|.:.     .|.|:.|    
Zfish  7474 RGEQAKCSANISVHEEALKIIEPLEDCEIEEKKTITFTCKVNRPNVTVQWMKAGQEITLSKRILY 7538

  Fly  8382 -TEDTKPTAVNADISMHQQ------FGTDVREQEPL-------------ESTLTRTED------- 8419
             .:..|.|....|.|:..:      .|||....|.:             :.|:|..||       
Zfish  7539 RVDKDKHTLTIKDCSLADEGEYTVVAGTDKATAELIISEAPADFAAQLRDQTITEFEDAEFTCKL 7603

  Fly  8420 ------LKPQTQTTESQFGLLQSLETSSCVTLEGESVLSVKERHPEQSA--AIGTSSALQVANIT 8476
                  :|......|.:.|....||...     .|..|.|||..|:...  |.|.          
Zfish  7604 SKEKAHVKWYRNGREIREGPRYHLERDG-----KECKLVVKECRPDDECEYACGV---------- 7653

  Fly  8477 RPQHMESLDRLDEQKVP------------------YYQANVNIGEITLP------NVEKIDSFDV 8517
              :...|..||..:::|                  .::|.:|...:.:.      .:.:.|.:.:
Zfish  7654 --EDKRSRARLFVEEIPVEIVRPPTDVFEPPGSDIVFEAELNKDRVEVKWMRNNMIIVQGDKYQM 7716

  Fly  8518 LSD-----LNTPDYNKSSKGRVQLI--ESTTSLKTTTAVVSE--------STEELKDLNITQPVH 8567
            :|:     |...:.....:|..:::  |.....|...|.:.:        .|:..|...:..|..
Zfish  7717 ISEGKVHRLQVCEIRPRDQGEYRIVAKEKDARAKLELAAIPKIKTTDQNLVTDAGKPFVMAVPYD 7781

  Fly  8568 IKPK------------------------------PYESDQ---KISISEQTNVLEHVSSLNPVLP 8599
            ..|:                              |.:|||   ||.|..:....|...:|:.:  
Zfish  7782 AYPRAEAEWFFDDISLPGQNIDTSNERTEYRLKEPKKSDQGRYKIVIKNKHGTGEAFINLDVI-- 7844

  Fly  8600 ALETIQSSIKSLHEINVRETDI---LEKEESLKDVDHISGRLAKIILDCTTGIAQVRQEETLEHE 8661
               .:...:|:||.::..:.::   .|:.||    |..|..||.::                 ..
Zfish  7845 ---DVPGPVKNLHVVDTADGEVSLAWEEPES----DGGSKILAYVV-----------------ER 7885

  Fly  8662 EDLKAPLIPLEKAIPASSELHRLPLTEYVQEQQGTSDMTDFKVSNKCASPNIDHLYETKSSEMIV 8726
            .|:|      .|....:::  |..:.||........:|..|:|   ||...:.      :.|.:.
Zfish  7886 RDVK------RKTWTMATD--RADIPEYCVGGLHRDNMYFFRV---CARNRVG------NGETVT 7933

  Fly  8727 YDSSINSVDSEFPAGIVPQKSLV----PFRHTMVTENVAFNASENFEILSADQQIATNVQDSLSQ 8787
            .|.::.: .::|.....|||.:|    .|..|:..|...|:..........:.:..|:|:...:.
Zfish  7934 TDEAVQA-KNKFDVPDAPQKFMVGVVNRFGATVSWEPPLFDGGSEVTSYIIELRDRTSVKWEPAM 7997

  Fly  8788 SIIAED----------------QIAFETEQNLGLETTPTHKPKLL----KDDQNLHAKLVDEA-- 8830
            .:.|||                ::..|.:..:|..:..|...|::    :....|:....::.  
Zfish  7998 VVKAEDLTATLSDVVENKEYIFRVRAENKAGIGQPSAATDPVKIMDPIERPSPPLNFNYTNQTRD 8062

  Fly  8831 -----------------TVYEAMGQEQKVDKYNIQQAEITHDL---------PQVY--------A 8861
                             |.|.....|...||:....|.:..||         .|.|        |
Zfish  8063 SVQLSWETPISNGGSMITGYIIEKCEDGTDKWLRCNARLCPDLYYRVSGLKFGQKYHYRVCAENA 8127

  Fly  8862 TDLQQTFEAEKEITTREQSYVAATTDIIPSRLGL------AMTTKTHPVEGIDVLLSSPPKPSLA 8920
            ..:.:..:|...:.. :..:|..|.|:...:.||      |:..|. |:.|..|     |||...
Zfish  8128 AGVSEPADAIGPLLA-DDPHVGPTIDLSGFKNGLEVIVPNALIIKV-PITGYPV-----PKPKWT 8185

  Fly  8921 QTNYEETQHEVRVRETQAIEESEELTDGRLLPVSAVESIDSTFKVTSDSQQPPVFDKELSIPTVS 8985
            ..:                   :|||.|           |....||.     |.:.:.:..|:|.
Zfish  8186 FGD-------------------KELTAG-----------DRVSMVTK-----PTYTELVVAPSVR 8215

  Fly  8986 PLEARAKPSLNLLQGTTTFDVIPLESSVL-----LKDTHVAVQKAQQEY-VAQVESNKVHVQMD- 9043
            |           .:||.|   :.||:.|.     ::...:|...|.::: ||:|..:.||:..: 
Zfish  8216 P-----------DKGTYT---LQLENDVTSVSGEIEVNVIACPSAPKDFKVAEVTRHHVHLMWEA 8266

  Fly  9044 ------------NLVMHKEDIFENAEI--ENFCKPITEGTQLETVVIEVVPIDNVGGIHLAPQPS 9094
                        |:        |..|:  :.:.|.|:....||..|.:|:            :..
Zfish  8267 PEHDGGSPVSGYNV--------EKREVSRKTWVKVISGVQDLEYTVTDVI------------EGK 8311

  Fly  9095 TLLATLTSTDIVNQSHVIDTQVPLEMESEAQAP-LDNIAQARIKSAEDHVHTNVSEVNVYEQTKA 9158
            ..|.::.:.:............|:.:.|.|..| ...:.:.|.|||:...  .:.|...|:...|
Zfish  8312 EYLFSVIACNKCGPGEPAYIDEPVNVSSPATVPDPPELLKWRDKSAKSIF--LLWEPPRYDGGAA 8374

  Fly  9159 IQDQNKHGLFV-KVSKNSDTSKAYLTTI-----QSTFLKEDILPKPNILQDTAQAAADELQSL-- 9215
            ::     |..| |..:.:|..:|....|     |.|.|.|            .|..|..::::  
Zfish  8375 VK-----GYIVDKCQRGTDKWEACGDPIPELKFQVTGLIE------------GQWYAYRVRAVNR 8422

  Fly  9216 --------VTEEVVSVSSIQETYELKIPLQKTANLTQQTPQNSVNVCQQLAYEETPDIAFEPHAL 9272
                    .|:|:::|.. :|..|:::..:..|.||.:....         .:...|:..:|...
Zfish  8423 LGASRPCKATDEILAVDP-KEPPEIQLDAKLLAGLTARAGTK---------IDLPADVLGKPEPR 8477

  Fly  9273 TRATTSSVPTFLKPAENATVNIYENIEGHGDFKPGTVNLTSNSNLNSELVVSVVQEVTSVPSLGS 9337
            .:.|.:.:  .|||.|..|:          |.|||...|:..:...|:....:::.|.:  |..:
Zfish  8478 VKWTKADL--VLKPEERITI----------DTKPGHSTLSIANTTRSDTATYIIEAVNT--SGRA 8528

  Fly  9338 LATVE---------PQELKAMPVTKSSTNLAYS---EEGGIPYVQITVE---------------- 9374
            .|||:         |.......:|..|..||::   ::||.|.....||                
Zfish  8529 TATVDVNILDKPGPPAAFDISEITNESCCLAWNAPRDDGGSPVANYIVEMRPTDKEEWQKLSATI 8593

  Fly  9375 ------EAKLVNTRADV----EENITSVTTEQPNMCIAA--SIQLPA------------------ 9409
                  ..|||..:..|    .||...:.|...::.|.|  |...|.                  
Zfish  8594 KQTAFKATKLVPLKEYVFRVSAENQYGIGTPAEHVPIVAKYSFDTPGAPTRVQPSDITRDAVTLT 8658

  Fly  9410 ---------------------------IEEKKL------------------------EN------ 9417
                                       |:..||                        ||      
Zfish  8659 WYEPDEDGGSPITGYWVERFDPETDKWIKSNKLPIKDTTFRVKGLPTKKKYKFRVLAENLAGQGK 8723

  Fly  9418 -ALQT----------PQFAS-----ESILKTS-------PQISRNAHFET------RTHEEEYST 9453
             :::|          |.:|.     :.|.|||       |:....|..|:      :|..||:..
Zfish  8724 PSVETDPVLIKDPIDPPWAPGKPFVKDIAKTSADLQWTRPEHDGGAKIESYIIELQKTGTEEWVR 8788

  Fly  9454 TTESLVTTQALRDDIDSTQKNVMQDVQMYKHFATKSLDKTVKVETDTNQATDTTHIKQK--TPTH 9516
            ..|.:.||       :.:.|.:|:. |.|. |..|:::  |..|::.:..:|....|::  .|..
Zfish  8789 VAEDVPTT-------EHSLKGLMEK-QEYS-FRVKAIN--VAGESEPSDPSDPVVCKERLYVPNP 8842

  Fly  9517 KLASSTTQITESPEIIKTIETISEDGSPSKKMIRTRLIKKVKGNKQEFTKIETVEEDDKQPETTV 9581
            ........||:....:|..|..|:.|||    |...:::|....::.:..::|..:|.|...|.:
Zfish  8843 PRWLEVVNITKINCDLKWTEPDSDGGSP----ITNYVVEKRDVRRRTWQAVDTTVKDTKYTVTPL 8903

  Fly  9582 TVEELPYEEEKPE------EIQELPEEVCVVETVTEDGKP------------------------- 9615
            :...|.......|      |..||.:.|...:|.|..|.|                         
Zfish  8904 SEGSLYVFRVAAENAVGISEFCELEDSVLAKDTFTTPGPPYALTVVEVSKRHVDLKWEPPNSDGG 8968

  Fly  9616 ---------KKKKIRTRVIKKVK-------------------------------GDKQEVTKIET 9640
                     ||:|:.||.:|..|                               |...|.|.|.|
Zfish  8969 RPITKYVIEKKEKVGTRWVKSGKTSGPESKYRVTDVDEGTEVQFQVRAENEAGVGHPSEPTVIMT 9033

  Fly  9641 VEEDDKQPETTVTVEEVPYEEE-------KPE------------EIQEL---------PEEVRVV 9677
            :|:....|...:.|:.|....|       .||            |:.|.         |..|:.:
Zfish  9034 IEDAISPPSPPLEVKIVDASREHINITWKAPEKNGGSPITGYHVELSEAETEKWMRINPRPVKEL 9098

  Fly  9678 ETVTEDG-KPKKKKI-RTRVIKKV-KGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEI- 9738
            ....|:| .|:||.: |.|.|..: ..|..|::.....::.|..|...|..:::...|.:..:| 
Zfish  9099 RFKAEEGIIPEKKYVLRVRAINAIGVSDPSEISDGVFAKDPDSAPTIDVATQDIVVVEGEKMDIK 9163

  Fly  9739 ---QELPEEVRV-----VETVTEDGKPKKKKIRTRFIKKVKGDKQEVTKIETVEEDDKQPETT-- 9793
               :.:|:...|     .|..|||......::....::.:| .|.|...:.||..::.....|  
Zfish  9164 IPYRAIPKPSMVWKKGDTELKTEDRLTLTCELNRVHLELLK-CKHEDAGVYTVTLENSLGSVTGT 9227

  Fly  9794 --VTVEEVP--YEEEKPEEIQ--------ELPEE---VRVVETVTEDGKPKKK------------ 9831
              |||..:|  .::..|.|:.        |.||.   ..::..|.|..:.:||            
Zfish  9228 VSVTVIGLPGQCKDISPSELTKNSCKISWEPPENDGGSPILHYVLERREAQKKTFLPVMSGENVL 9292

  Fly  9832 -------------KIRTRVIKKV-KGDKQEVTKIETVEEDDKQPE--------------TTVTVE 9868
                         ..|.:.:.|: .|:..|:.....:||..:.|:              .|||..
Zfish  9293 SFVVKDLMLNSEYHFRVKAVNKIGSGEFLELRNPVIIEEQKQHPDPPIEVAGLNPTSNSITVTWM 9357

  Fly  9869 EVPYEEEKP------EEIQE------------LPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGD 9915
            ..||:...|      |:|::            :|.....|..:|| ||..:.::|...|......
Zfish  9358 APPYDGGCPITGYIIEKIEKDGDRFERCVPNLVPGFSYTVTGLTE-GKEYQFRVRAENIAGASDP 9421

  Fly  9916 KQEVTKIETVEEDDKQPETTVTVEEVP-YEEEKPEEIQ--------ELPEE--VRVVETVTEDGK 9969
            .:....|...:..| .|:.|:...... ...:|.|||:        ..|..  :|..|.|.:  .
Zfish  9422 SRSTPLIMAADPVD-PPQVTLFARIASGLSIKKGEEIRLDAYISGSPYPTVTWLRNDENVRQ--P 9483

  Fly  9970 PKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEE------------- 10021
            |.|||  ..::||.|         :||:.:.::......|:.:.||:.|..|             
Zfish  9484 PAKKK--PEIVKKKK---------KTVQPEPEEEFHPPLVDRLSYEQTKKGETALMVRDAIRTDH 9537

  Fly 10022 ---------------------IQELP--------EEVRVVETV------TEDGKPK------KKK 10045
                                 :.:.|        :|:|....|      .:||..:      :||
Zfish  9538 GNFTIRVENAHGFATASCDVNVLDKPGPPVNFGFDEIRNTSVVCTWDAPLDDGGSEIINYILEKK 9602

  Fly 10046 IRT-------RVIKKVKGDKQEVTKIETAEEDDKQPETTVTVEE-------------VPYEEEKP 10090
            ..|       .|....||....|||:    .:.|:....||.|.             |...:.:|
Zfish  9603 DNTSDDIGWVTVTSTHKGYNYPVTKL----IEGKEYIFRVTAENKFGCGHPCYSEPLVAKNQFEP 9663

  Fly 10091 EEIQELPEEVRVVETVT--------EDGKP------KKKKIRTRVIKKVKGDKQEV--TKIETVE 10139
            .:...:|....|..:..        ::|.|      :::::.::...:|..:....  .|:|.:.
Zfish  9664 PDAPNVPRIGEVTSSTVALSWHEPKDNGSPILGYWVERREVNSKYWIRVNSNLLSALNVKVEGLM 9728

  Fly 10140 EDDKQPETTVTVEEVPYEE-EKPEEIQELPEEVRVVETVTEDGKPKKKKIRT------------- 10190
            |.      .|.|..|..|. ..|.|.....:....::.:...|.|..|.:..             
Zfish  9729 EG------LVYVFRVCAENLAGPGEFSVPTDPQAAMDPILPPGPPVPKIVDVTNTTIDISWQPPL 9787

  Fly 10191 ----------RVIKKVKGDKQEVTKIETVEEDDKQPETTVT-----------VEE---------V 10225
                      .|.:.:.|:|..|...|...:|.|...|.:|           |.|         .
Zfish  9788 YNGGGEILGYHVERCLVGEKDWVRCTEFRCKDRKYTVTGLTEGADYNLRVYAVNEGGHGAPGMTE 9852

  Fly 10226 PYEEEKPEEIQELPEE--------VRVVETV----------------TEDG-KPKKK-------- 10257
            |.:.::|||...:..:        :|..||:                |:|| :|.|:        
Zfish  9853 PVQAKEPEEAPGVEFDISVRNGVIIRAGETLRLPAVVTGRPVPEVKWTKDGAEPDKEHVVIEAEI 9917

  Fly 10258 KIRTRVIKKV---------------KGDKQEVTKIE----------------------------- 10278
            |..|..|||.               .|.|....|::                             
Zfish  9918 KSSTLSIKKALRTDHGIYQITGTNPSGTKSVSVKVDVMDVPGPVVDLKTVNVSKKMISLTWSDPL 9982

  Fly 10279 ----------TVEEDD------KQPETTVT-----------------------------VEEVPY 10298
                      .||..|      :||.....                             ||..|.
Zfish  9983 DNGGSDIMGYVVERKDAKMHIYRQPLEVAACKCDIVGLLDGEEYMFRVVARNKFGLGAPVELGPV 10047

  Fly 10299 EEEKPEEIQELPEEVRVVE----TVT--------EDGKPKKKKIRTRVIKKVKGDKQEVTKIETV 10351
            ....|:.:...||::|..|    |:|        :.|.|    |....|:|::.|..|.    .|
Zfish 10048 LAVDPKGVPSAPEKLRYTERTKNTITLTWEAPRSDGGSP----IIGYYIEKMRQDSNEY----DV 10104

  Fly 10352 EENDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKV-KGDKQE 10415
            ...:...:.|:|:|                   .:.|.:..|       .|.:.:.:| .|:..:
Zfish 10105 ANRNLCKDLTITLE-------------------NLTENMMFD-------FRVKAVNEVGNGEPSK 10143

  Fly 10416 VTKIETVEEDDKQP--------KTTVTVEEVPYEEEKPEEIQELP-------------------- 10452
            ...: .::||:..|        |:...:.......|.|.||..||                    
Zfish 10144 AISV-NIQEDENSPTVKWMKFFKSDAIIVRKGAAIEIPAEIVGLPLPTFEWTKNGVVIDQPTEAM 10207

  Fly 10453 ----EEVRVVETVTEDGKPKKKKIRTRVIK----KVKGDNQEVTKIETVEEDDKQPETTVTVEEV 10509
                ||:......|:.|.|:..:..|.:.|    ..:|..|...:::.:  |...|...:.|.::
Zfish 10208 TLESEEINRQTITTKIGIPESVRQDTGMYKLTATNTRGVGQRTMRVDIL--DRPLPPRNIVVSDI 10270

  Fly 10510 PYEE-----EKPEEI--QELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIET---- 10563
            ..|.     :.||:.  .:|...:     |.:....|||....::...:...:..|.|:|.    
Zfish 10271 KAESCYLTWDAPEDNGGSDLTNYI-----VEKRDASKKKSDWDQLTCCIMDRRYGVYKLEAYGTY 10330

  Fly 10564 ---VEEDDK-------QPETTVTVEE--VPYEEEKPEEIQELPEEVRVV-ETVTEDG-------- 10607
               ::.::|       :.|..|..:.  :|...::|..|......:.|. |...::|        
Zfish 10331 QFQIKAENKYGISDGCESEKVVLKDPFGLPGPPQRPRIISHTRSSMVVTWEPPKDNGGSTIQGYW 10395

  Fly 10608 --------------------KPKKKKIRTRVIKKVKG-------------------DMQEVTKIE 10633
                                ||..|.:...|:..::|                   :..|.....
Zfish 10396 LEKRERGAVYWSRVNRAPVTKPAVKGLEYNVLHLIEGAEYKFRVMAQNAAGVGPPSEATECVFAL 10460

  Fly 10634 TVEEDDKQPETTVTVEEVPYEEE----KPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVK 10694
            .......||...|..::.|....    .|:.....|.:..:|| |.::|..:.|:|.|       
Zfish 10461 DPRNPPSQPPAPVVTDKSPSSVSLSWTPPDRDGGSPIKGYIVE-VQDEGSHEWKRINT------- 10517

  Fly 10695 GDKQEVTKIETV---EEDDKQPETTVTVEEVPYEEEKPEE----IQELPEEVRVVETVTE----- 10747
            .||..:|...||   :|:.|.....|.|......|..|..    :|::.||..:...||.     
Zfish 10518 PDKLILTNSYTVPGLKENKKCRFRIVAVNAAGESEPSPRTSDIIVQDILEEPVITIDVTSQELLN 10582

  Fly 10748 -------------DGKPKKKKIRTRVIKKVKGDKQEVTKIE----TVEEDDKQPETT--VTVEEV 10793
                         .|||     ...|..:..|......|.|    .|:.|....:||  ||:.| 
Zfish 10583 CRAGTTLKIPATISGKP-----LPNVTWEFDGTAPSEKKNERHTLPVDSDISSSDTTSVVTIPE- 10641

  Fly 10794 PYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETT 10858
                      .:|....|.:.|.......|..|:|..|: .:.|..:::| |..:...      |
Zfish 10642 ----------SKLHHSGRYIITANNQAGTKIVKVRVNVL-DLPGAPKDIT-ISDITRG------T 10688

  Fly 10859 VTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKK-----KIRTRVIKKVKGDKQEVTKIET 10918
            ..:...|.:.:..:.|:..     .:|..|.:||...|     ..::.|:..:...::.:.:|..
Zfish 10689 CRLSWKPPDCDGGDRIKSY-----FIEKKTVEGKAWTKVNPACTTQSLVVPDLIEGQEYLFRIRA 10748

  Fly 10919 VEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVET----VTEDGKPKKKKIRTRV----IK 10975
            .......|.|| |:|..  :...|....:.|..|::::.    ||...||.|......|    |:
Zfish 10749 ENRFGYGPHTT-TIEGT--KARDPIHPPDPPTRVKIIDVSKGIVTLTWKPPKNDGGAPVTHYNIE 10810

  Fly 10976 KV----KGDKQE-------------VTKIETVEEDDKQPETTVTVEEV----PYEEEKPEEIQ-- 11017
            ::    .|::||             ..|:|.:.|..:.......|.||    |.....|..::  
Zfish 10811 RLWWDSSGNQQESWRQCNRRDIDTTTFKVEDLHEGAEYEFRVKAVNEVGASRPSSTAGPIIVKDQ 10875

  Fly 11018 ------ELPEEVRVVETVTEDGKPKKKKIRTRVIKKVKGDKQEVTKIETVEEDDKQPETTVTVEE 11076
                  ||||.:.:     |.|..      ..::.|:||                .|..|:|.::
Zfish 10876 NRAPFIELPEFMEI-----EQGTD------AHIVAKIKG----------------CPFPTLTWQK 10913

  Fly 11077 VPYEEEKPEEIQELPEEVRVVETVTED--------GKPK----------------KKKIRTRVIK 11117
            .|  ..|.|...::..:..:.:.|.:|        ||..                .|::|..|:.
Zfish 10914 AP--PHKGENKVDVEYDEHINKLVADDSCTLLIQQGKRSDTGLYTLTASNSLGTVSKEMRLNVLG 10976

  Fly 11118 KVKGDKQEVTKIETVEEDDKQPETTVTVEEVPYEEEKPEEIQELPEEVRVVETVTEDGKPKKKKI 11182
            : .|......|.|.:..:.      :|:..:|.:::...:|.....|.|||...|......:.|.
Zfish 10977 R-PGAPSAPIKFEEIRAEQ------ITLSWLPPKDDGGSKITNYTIERRVVNRKTWIPVTSEPKE 11034

  Fly 11183 RTRVIKKVKGDKQEVTKIETVEED------DKQPETTVTVEEVPYEVEKP-------DEIQ---E 11231
            |...|:.:....:.:.:|....:.      |.:||....|...|.:.|||       |.:.   |
Zfish 11035 RLYTIENLMPGHEYIFRIRAQNKYGVGDPLDSEPEVARNVFMPPGQCEKPTISSVTIDSMTVNWE 11099

  Fly 11232 LPEE----------VRVVET-------VTEDG-KPKKKKIRTRVIKKVKGDKQEVTKIETVE--- 11275
            .||.          :...||       ||.|. :|....:..||...::| .|.:.::..:.   
Zfish 11100 EPESDGGSPITGYWLERKETTSKRWSRVTRDPVRPMPMGVSHRVTGLIEG-SQYLFRVSAINAAG 11163

  Fly 11276 ----EDDKQP---------------------ETTVTVEEVP---------------YEEEKPEE- 11299
                .:..:|                     :||..:|.:|               |:||..|. 
Zfish 11164 VGPPSEPSEPTFAREPIAPPSPPTPKVTDWTKTTADLEWIPPLKDGGSKIIGYFVEYKEEGTEAW 11228

  Fly 11300 IQELPEEVRVVETVTEDGKPKKKKIRTRVI---KKVKGDKQEVTKIETVEEDDK----------- 11350
            ::...:|||..:.|. .|..:....:.|||   ....|:..||.  :.:|..|:           
Zfish 11229 VKAKDKEVRGTKFVI-TGLKENALFKFRVIALNAAGLGEPGEVA--DALEMKDRTILPVLELDVS 11290

  Fly 11351 ---------------------QPETTVT--VEEVPYEEEKPEE---------IQELPEEVRVVET 11383
                                 ||...:|  .:|.|...|...|         |::.....|.|.|
Zfish 11291 VKEKMVIHAGGVIRILAYVSGQPPPVITWSRDEYPVPSEAVIETTSISCSMVIKDCTRAQRGVYT 11355

  Fly 11384 VT--EDGKPKKKKIRTRVIKKVKGD----------KQEVTKIETVEEDD-------------KQP 11423
            :|  .||...||.:...|: .|.|.          ..|..|:.....||             ::.
Zfish 11356 ITAKNDGGEVKKSVIVEVL-DVPGPVGVPFTAENLTSESCKLNWFFPDDDGGSAISNYIIEKREA 11419

  Fly 11424 E-----------------------------TTVTVEEV---PYEEEKPE-------EIQELPEEV 11449
            |                             ....|..:   |:.:...|       .:.:.|||:
Zfish 11420 ERKAWTSCSYTAGRQNAVVNNLVLKKAYFFRVAAVNAIGVGPFNQTACEIVIKDRINVPDRPEEL 11484

  Fly 11450 RVVETVTED-----GKPKKKKIRTRVI------KKVKGDK-QEVTKIETVE-----EDDKQPET- 11496
            .|. .:|:|     .||.|....:.||      :.:..|| ..:||.:.:|     :..::.|| 
Zfish 11485 EVT-AITKDHISLTWKPPKNDGGSEVISYILEARTIGKDKFVRLTKDKLMERRYTYDGLREGETY 11548

  Fly 11497 ---TVTVEEV----PYEEEKP----EEIQ----ELPEEVRVVETVTED--------GKPKKKKIR 11538
               ...|.||    |....||    :|::    ||....:||..|.|.        |||......
Zfish 11549 EFRVSAVNEVGPGKPSFSTKPITCKDELEPPTIELDFRDKVVVRVGESFALQGRYTGKPAPSITW 11613

  Fly 11539 TRVIKKVKGD-----KQEVTKI----------------ETVE---------------EDDKQPET 11567
            :|..|::|.|     |..:|.:                .|||               :....||.
Zfish 11614 SRDDKELKADNHIKFKNTLTTMCLGIVKAQRGHSGKYCVTVENCTGARKGICNVIVADRPLPPEG 11678

  Fly 11568 TVTVEEV----------PYEEEKLEEIQELPEEVRVVE-----TVTEDGKPKKKKIRTRVIKKVK 11617
            .|..:||          |..::...||.....|.|.|.     |||.    ...|...:|.|.|:
Zfish 11679 PVVFDEVHRDHMVISWKPPLDDGGSEISNYIIEKRDVNRDMWTTVTS----ATTKTHCKVPKLVE 11739

  Fly 11618 GDKQEVTTI---------ETVEEDDKKAETTVTVEETELSAPSVGKVQLKKRVIV-QKPEDA--- 11669
            | ::.:..|         :.:|.::.||:....|.|.. ..|:|..|.....::: .:|.|.   
Zfish 11740 G-REYILRISAENMYGISDPLESEEMKAKDLFRVPEAP-EQPTVKDVYNDSALVIWNRPRDGGKP 11802

  Fly 11670 VTVFELPERKSVILSEKEDGTPTKTVIKTRIIKKIQGPNMEVTKVQTVE-----EYEKAPQTIVS 11729
            :|        :.||.:||...       .|..:..:.|....|:.:..|     |||   ..:.:
Zfish 11803 IT--------NYILEKKEPSA-------KRWSRATRDPIYPATQYRVQELVEGCEYE---FRVTA 11849

  Fly 11730 VEKFNTPFPELPEERL--SEVVMLPDEVFESEAVDEEGRLKMIKTKKRII---RKPALDNTEEVT 11789
            ..:..|..|.:|.:.:  .:.::||......||||        |||..:.   |.|..|...:: 
Zfish 11850 ENEIGTGDPSVPSKPILAKDPIVLPSPPVLPEAVD--------KTKDSVSLSWRVPRHDGKGKI- 11905

  Fly 11790 EIG-IIEQDNVEPIYSVKIQERPLTESKPEDSKLIELPEHVTELNVILPDGKK-KRRTVKSRAFK 11852
             .| :||......|..||..|.|  ||.| |:|.:     ||.    ||:|:: :.|.:...|..
Zfish 11906 -FGYLIEYQKPGAIEWVKANETP--ESCP-DTKFV-----VTN----LPEGEEFQFRIMAVNAAG 11957

  Fly 11853 KSLDDDLDEVTTIHIIEEE---------DKEPLTKVNIEVVPSDEISITPIPI-------EELPE 11901
            ||....:.|...:|...||         .::.|..|..::..|..:...|||.       .|:|.
Zfish 11958 KSEPAYVKEPVKVHDRLEEPELLLHANMSRDHLAMVGTDITLSATLKGMPIPTVSWKKNDGEVPA 12022

  Fly 11902 ETVFTEELDENKKPKKKTTK------TRTFKKRGPDDDEYFQIQTIDEEGKEPISLIRVVSDENI 11960
            ..:.......:|...||.|:      |.|.:...........:..:|:.|          ...|:
Zfish 12023 HCLIEVTATGSKLHIKKCTRADSGNYTITIQNAAGSKSATCAVLALDKPG----------PPRNL 12077

  Fly 11961 ADIIDISKLDDEKVLKHKQKPH-------KHKVDKPKADNTETEHPVYITTFK------------ 12006
            |    ||::..|......|||.       .|.:.:.|....|...||...:.|            
Zfish 12078 A----ISEITSESAYLTWQKPEDDGGAVISHYIVQKKDVAAENWVPVCAASKKLSLMAQYLMEGT 12138

  Fly 12007 ------SVQNEDGETTIQTENKRISQEEGIVVEEVLSDTELIPEDKTQLHL-----EITEVSEPT 12060
                  :.:|:.|.:.....||.|...:.:.......:...:..|||::.|     :.|..||.|
Zfish 12139 QYLFRVAAENQFGRSAFVETNKPIKAVDPLYPPGPPKNLHHVDADKTEVWLQWEWPDRTGGSEIT 12203

  Fly 12061 DQYYKEYTITEPEEASADALQKPTKDKTPKQKKTLETPIEEVDETVIIDEGTGEQTDQIAIKRKP 12125
            .     :.:...||.:.|.:          ..||:..|...|...|   ||   :|.:..:|.  
Zfish 12204 G-----FIVEHQEEGATDWV----------TFKTVSNPQCHVTGLV---EG---KTYRFRVKS-- 12245

  Fly 12126 RKVQGNVQVEAVDEK-PIEKKEKAKKKKVVKTKRDEMDDYIQFLIHQEIPKTVLQPYQRTEMELP 12189
               |..:.:...|.. ||..:||.....:      |:|                           
Zfish 12246 ---QNAIGISRPDTSVPITCQEKTLAPTI------EVD--------------------------- 12274

  Fly 12190 QRARRDSSFKQPVKLTPMKIEKVEFKKPKMVEISSVVEFPQ-MLKLKAPKQRPQEE-KKKKNEAS 12252
                        |||    ||.:      :|:..|.:..|. ||.:..|..:.|.| .:.|.|..
Zfish 12275 ------------VKL----IEGL------VVKAGSTILLPAVMLGIPTPTAKWQSEGNELKTEGK 12317

  Fly 12253 FKNKKLKSWIRFVPYAPYCFPYVVTE-LETNREVGELSRNVDEAEEVLKLRPKKFKHSKPEKAEL 12316
            ||                    :||| ..|...:.|.:|                          
Zfish 12318 FK--------------------IVTEGNSTTLTISECAR-------------------------- 12336

  Fly 12317 EEADLGAYESDHSDK--SNKELLH------PKYKRGKKEKIE-TPDESRKLKFGKGKVPQNEEAS 12372
              .|.|.|....|:.  |....||      |....|....:| |||.    ...:.:.|:::..|
Zfish 12337 --TDSGEYSLTVSNPAGSKSVALHVTVLDVPSAPVGPVNILEVTPDH----MIIQWRAPKDDGGS 12395

  Fly 12373 EEVNLKPVKLDIAEIEDAEMP-----VRTQEEEVVKKKKPKKSSKPEEGLQFEPIEFEEMERTSD 12432
                  |:...:.|.:|.:.|     |.:......|.|.|:.    |:|.::            .
Zfish 12396 ------PLMSYVVEKKDVKKPWEPWSVVSSGSTSTKAKVPRL----EKGREY------------I 12438

  Fly 12433 IREESDTSVSVDTSTQEKPIYKKKKKVTPSPQKNQYKILPGQPREFEET----------PEDD-- 12485
            :|..::..:.:....:..|...|:....|.|        ||||...:.|          ||.|  
Zfish 12439 VRVRAENKIGIGAGLESPPTIAKQMFDPPGP--------PGQPTCSDITENAVTVSWAEPETDGG 12495

  Fly 12486 -------LNLRKRQGERPDDDKA---DTKLK-------PFYKFEVLDLEPEGVQAETVPLSETIA 12533
                   :..|:..|:....:|.   |.:.:       ..|:|.:......||...:.|.....|
Zfish 12496 SPVSGYIVERREMTGKWIRVNKTPVLDIRYRVCGLFEGNSYEFRIFAENVAGVSQPSYPSDPMKA 12560

  Fly 12534 KE----PKKKRKIKVKTEQEDNTIEIVPLSP-EDNDEQIFEITVTSSEIPQ-GDAKAKTIGKK-- 12590
            |.    |.....||:| :...:..::|...| .|....|....|   ||.: |.|:...|.|.  
Zfish 12561 KRPITPPGPPSNIKLK-DWSKSYADLVWTKPSRDGGSPILGYVV---EIQRSGSAQWDKINKDLI 12621

  Fly 12591 ------------------KVKRMNK------QELDDFVTELQEE---PNQEVYETRMSDFYEVK- 12627
                              ::|..||      :||.:  |.|.::   |.:...:....|...|: 
Zfish 12622 KFCAFRVPGLNEGIEYRFRIKASNKVGDGEPRELTE--TVLAKDILVPPEVTVDVACRDLLTVRA 12684

  Fly 12628 ------LTELPSEMDSDKP-TK--RILRHEKGDEV-QVLEIVESVVAPGEEPFYEINVISSANTE 12682
                  :|.:....|.:.. ||  |:|..:|..|: ....:||.|:.......|....|.:.|:.
Zfish 12685 GQIINLVTRVKGRPDPEITWTKDARVLGRDKRTEMNNNFPLVELVIQDAVRADYGKYAIQAKNSS 12749

  Fly 12683 GDSE----------------------------------------EITTDKIK-----KKSRKIKK 12702
            |.::                                        |||..||:     ::...:..
Zfish 12750 GQAQATIIVNVLDIPGACQNLKVAYVTKDSCMVSWENPEDNGGTEITNYKIECRQPSQRGWTVVS 12814

  Fly 12703 DDLDAYIQQLINAEIPVTELEKYEKIDVDGKAKKPKKLKAKTK----KPIIDEGETLQVGVTEHE 12763
            .|.   .::|:.|.: |...|.:.::..:.|.......::||.    .|:...||.....:||..
Zfish 12815 SDC---TKRLVKAPL-VQNCEYFFRVSAENKIGAGPPTESKTPVLAVDPVEKPGEPENFQITEIG 12875

  Fly 12764 PT-KKLKTKKPE------------EKKNVIEKELAEHE-----AVPE----YDEFLINKTESERP 12806
            .| ..||.||||            |||   .||..|.|     |:.|    .|..:.|:....|.
Zfish 12876 KTFVFLKWKKPEYDGGSRNLAYHVEKK---PKEADEWERLHKGAIKETYFMADRCIENQIYQFRV 12937

  Fly 12807 QEKRVEETEKDIVPIVDKVLADLNDCLPFVVVEEDLKDMPL-----------ATDVIALEDEKII 12860
            |.|. |..|.:.|...:            |:|:|:|....|           |.|.:::|.|.:.
Zfish 12938 QTKN-EGGESNWVTTAE------------VLVKEELVQPELKVKMVGTLVVKAGDAVSIEAELLG 12989

  Fly 12861 RKR-KVRAKKD------SKQYEIEI----------IETEKPGDIPDEARVIVITTEVSG------ 12902
            :.: :|:..|:      ||...:::          :...:.|   |..:.|:..|..:|      
Zfish 12990 KPQPEVKWSKEGDTRDISKGLRVQVETGTNFTKLQLSNSRRG---DTGKYIITATNAAGTCSAEA 13051

  Fly 12903 --DTIDGPAPSTTEAPKKSVRKVKKEKLKEFIVNIVEEAPLDHVS-EIYEDVLR----------- 12953
              :.:|.|.|         :|.:|...:......:..|.|.|... |||..::.           
Zfish 13052 KVNVLDRPGP---------IRDLKVSDISIDRCKLAWEIPEDDGGCEIYNYIIEKCEAKRGVWSI 13107

  Fly 12954 ------------TPFRESSE-----KEDIPSFTTTVVEDEIV----------NPVLPEKIKTVDD 12991
                        |...|.:|     :.:........||.|.:          .|..||..|...|
Zfish 13108 HSAAIITNSAKVTRLIEGNEYIFRVRAENKMGAGPAVESESIIARTQFSRPGAPDAPEVTKITKD 13172

  Fly 12992 VRV------PKDKKKKIDN---QKK----IKISEFEPTPTSEDSTIEEYTPKLSEHDEDLQTD-E 13042
            ..|      ..|..|.|..   :||    |:.:....:|.:  .|....|..|..|:...:.. |
Zfish 13173 TMVVMWCSPDNDGGKPITGYILEKKEEHAIRWAPVVKSPYA--GTQMTVTSLLPNHEYQFRVKAE 13235

  Fly 13043 YSVDVKDSLPKSKKKSTKKQKKESLPGPISLYTIRIEETTPEPI----TEKIYEDGKEVVRVINK 13103
            ..:.|.|: .|..:..|.:...|. |||:|  .:::.:::...|    |:..|:.|..::..:.:
Zfish 13236 NEIGVGDA-SKPSRTFTARDPVEP-PGPVS--NLKVTDSSKTSITLAWTKPTYDGGAPLIGYVVE 13296

  Fly 13104 RRIK--KKAGPK--------------EYLIEVIE---TYE-------------DNNPEADVVIRT 13136
            .|:|  .|.|.:              |:.:..::   .||             ..|.|..|..:.
Zfish 13297 IRVKGTGKKGDEGWKRCNVAAQLIGTEFTVSSLDEKLEYEFRVSAQNQVGMSQPTNLEGAVTPKE 13361

  Fly 13137 IETTPSIDSKPQEDHKIQV----------VQEKKPKTESL------DNYIQK----LID------ 13175
            :...|.||...:....:.|          ....:|..:.|      ||.:||    |||      
Zfish 13362 VLEAPEIDLDAELKKGLTVRAGCPIRLVATIRGRPAPKVLWRRMGKDNVVQKGHVDLIDTMTFLV 13426

  Fly 13176 -QEIPQVDHKEFKATVLETSPESKKAKKIKKHHKKTTEVIDGIPITVI-----EVTIQETETD-D 13233
             .:..:.|..::...|  :||..:||..:......|...:||:.:|.:     .:|....||| .
Zfish 13427 ISDSTRDDSGKYSLNV--SSPAGEKAVFVNVKVLDTPGPVDGLEVTDMTMSSCNLTWSPPETDGG 13489

  Fly 13234 EDFKPDEVTLKEIDHE-------NAEEAPKVLKSKVSEEK-------------------PKSKKE 13272
            .:.....|..:|||.:       |.|:....:.:.|...:                   |||   
Zfish 13490 SNVTHYIVEKREIDRKTWATVKANVEKTTFKISNLVPGTEYYFRVVAVNEYGPGVPRVTPKS--- 13551

  Fly 13273 KSLEFKIAEEDKPKPVLEDISEDVQVVQIIEEDGTPKQVEIKKKKVSRKHGPKEQVFEITETKAI 13337
                 .:|.:...||   |..:.|.|::|.:...|...|:..:...::..|......|:...|..
Zfish 13552 -----YLASDPVSKP---DPPQKVDVLEISKNSATVGWVKPMRDGGAKIDGYVIDYLELPMPKPP 13608

  Fly 13338 DEPLSEVTVVEITDE---------QPQEEVLPAQEKKPIKKQKKLKPEDVNTY-VVKVLE----E 13388
            .:|      ||:..|         ||..|.:.|:|:|..|::||   |:...| |||.|.    .
Zfish 13609 KQP------VEVEGEAEPGVEPVVQPPPEPVAAEEEKEEKEEKK---EEWTPYTVVKGLSISIAG 13664

  Fly 13389 LTE--PTQFETIPEDADDKPQPVIEDISENVQVVQIIEEDGTPKQVEIKKKKVSPKHGPKEQVFE 13451
            |.|  ..:|.....::.....|     :|..:..:|.|:...||  .|..:.|:.|.|.|.:|..
Zfish 13665 LKEGRKYRFRVAARNSMGSSLP-----TETREAYEIKEQMFEPK--IIMTELVTAKAGAKLRVEA 13722

  Fly 13452 ITETRPSDE---PLAEVTIVELTEEGLNKD-----IVIPQ-------EKKTVKKPKKLKPEDIQS 13501
            :...:|:..   ...|..:|..:...::|.     ::|..       |...|.:....|.|....
Zfish 13723 LVSGKPAPACQWKRGENNVVSSSRLAVHKSQNMCVLIIKDVSRQDSGEYSLVAENSSGKIEQTLK 13787

  Fly 13502 YVIRVLEEFNEPQWPASTEKPIIEDIAESIEIVPVTEEDG--ITKEVEVKKKKVSR--------- 13555
            .:||.:....||.:..|.    |:..|.::.....||:.|  ||..| |:|..|||         
Zfish 13788 IIIRDIPGPPEPPFEISD----IDSDACTLSWNKPTEDGGSNITNYV-VEKCDVSRGDWVTALSS 13847

  Fly 13556 --KQGT--------KNQVFEI-IETKTS-DEPLAEVTILELSGDKSQEVTILPKEKKPIKKTIKL 13608
              |.|.        |..:|.: .|.:.. .:|||.                        ::.:..
Zfish 13848 CGKAGCRIGKLIPGKEYIFRVRAENRFGISDPLAS------------------------ERMVAK 13888

  Fly 13609 KPEDVE----SYVVNVLEEFCEPQSFESPEPTEGEAHETKTKTKKPKKPI--VKAPENVILIEEM 13667
            .|.||.    :..:|.:.:.|...:::.||...|.........:|.:..:  |||.::|:...|.
Zfish 13889 FPFDVPGEPLNCRINKVNKDCMFVAWDKPESDGGSPVTGYYIERKERNSLLWVKANDSVVRTTEY 13953

  Fly 13668 APETVIENI--------VNEIGEEVKQVKT--------------------TK--------KLKKK 13696
            ....:||.:        :|..|:.....||                    ||        |.|..
Zfish 13954 PCAGLIEGLEYTFRVSAINRAGQGKPSKKTDFITARTPVDAPGKPEVLDVTKNAVSLVWTKPKND 14018

  Fly 13697 EGPK--EYLIEIK----------ETYEENKPEGDIEITTTELVPEGS----------------PD 13733
            .|.|  .|.:|..          .|..:|.|..:...|..|   ||:                |.
Zfish 14019 GGSKIIGYYVEAMRLPGDTWVRCNTSSQNVPREEYTATGLE---EGANYQFRVIAKTAVNISRPS 14080

  Fly 13734 ASDDQPVIV------------VQKIKKKKPVKDDLDKYIQQLIEQEITKTPLEEYEPTEMDSKKK 13786
            ...| |::|            || :||..|||...|    ..:|.|:...|:.:...::.....|
Zfish 14081 EITD-PILVSAENVPPRIELSVQ-MKKMLPVKAGSD----VCLEAEVFGKPMPKVTWSKNGETLK 14139

  Fly 13787 PKKKVKSHNKKTIEVIDGLPVT--------IHEFN------------VEDIVSEPEDMETPKTLL 13831
            ..|:.|...|:.:..:....||        ||..|            :.||...|..::..:.|.
Zfish 14140 ADKEFKMSQKRHLFSLSLDAVTKLHAGNYGIHAANASGNTTAEIQLKILDIPGPPASVKLDEILS 14204

  Fly 13832 DEIK---EIPQLPDDS--SKYLVNISD----EFGEADKPIKQPTQDQPIKKEKPLKKKKDVEYPV 13887
            |.:|   |.|.:...|  :.|:|:..:    |:.:....|.:.|.:..::     :..:..||..
Zfish 14205 DRVKLSWEAPLVDGGSPITNYVVDKRETSRAEWAQVSAKISRDTTECSVE-----RLIEGHEYQF 14264

  Fly 13888 SLEAFDH---TVKVVSEP-------TLEG-----TVKEVTVKKRKVSRRKGSKDHIFEITETTSE 13937
            .:.|.:|   ...::|||       |:.|     .:..:|.:...||.::.|.|....|.....|
Zfish 14265 RVRAENHYGTGDAIISEPVVARNPFTVPGACDPPVLTNITKEHMTVSWKEPSDDGKSPILGYLVE 14329

  Fly 13938 DRPTAEVTVVELSSDEVLDS-------EEKPKHERKIVKKPKQ-LKKDDVEEYIINIIEEFIQPI 13994
            .|.|.||...:::...:|:.       .|..::|.:::...|. |.|........:.::....|.
Zfish 14330 KRETKEVNWTKINRKPLLERTLEVGGLSEGAQYEFRVIAVNKAGLGKPSDPSNAASALDPLYPPG 14394

  Fly 13995 P-----------------------------VG-LVE-DEVEKVQKEETKKPKKSPIT-YIAT--- 14024
            |                             :| ||| ..:..........||....| |:.|   
Zfish 14395 PPISPKAIDTTNSTIKLTWTKPANDGGSDILGYLVECKRINTTDWIRCNVPKNLQDTNYVVTGLL 14459

  Fly 14025 EQEDNDNNYDALVKEDLDQPIERALEKPSSPLEYTISVEED---------SVGEEQK-------Q 14073
            |..:......|:.|....||.|...:..:..:..|...|.|         :.|.:.|       :
Zfish 14460 ENSEYQLRVSAVNKIGFSQPCEVPEKHIAKDVFVTPEAELDAELKDTLVLTAGSKMKLHAKIKGR 14524

  Fly 14074 PKPK----KISKPKSIKQPSVDKSPD-----------------YLVNVISEE---------SIID 14108
            |.|:    |::.....:|..:.|:.|                 |::|:.|..         .::|
Zfish 14525 PIPRVTWAKMNTNIKDRQGIIIKTTDTDTLVCVEKVNRYDAGKYILNLDSVSGMKMYTVIVKVLD 14589

  Fly 14109 EPIPE-DYVVTEAAEEKPS---EEP---------------------------------TFKVEEL 14136
            .|.|. :.::.|.:::..|   :||                                 :||:|:|
Zfish 14590 TPGPPLNLMIKETSKDSASILWDEPLIDGGSEITGYIVDKRDAERKAWSNVTTSCTKTSFKIEDL 14654

  Fly 14137 E--------------------TEAVEKEVTDDDKGE--------TTKQSVT---KRKIKKLVGPK 14170
            |                    .|.|:.....:..|.        .||.|.|   |:.|..  |..
Zfish 14655 EPGRSYCFRVLAQNQYGIGEPCETVDAVRASEQPGPVMDFKTLLVTKDSCTLSWKKPISD--GGS 14717

  Fly 14171 EEIIEIVETKTGDTPEYEVIVTTEEVQEKSKEAPEEKKAK------------TVRKAKKIPKD-- 14221
            ..|..::|...|: .:::.::.::.:|..:|:..|.::.|            .|::...:.||  
Zfish 14718 RIIAYVLEVLNGE-DKWKELLRSKNMQYSAKDLVEGREYKYRVFATNDSGDGPVKELSVLAKDIN 14781

  Fly 14222 -----DLQD-----YIQKLIEQDIPKTELEKYEKIDLDEPVKMKRKPIKKVKQSEEQPKEETEEP 14276
                 ||:|     ||.|            :...:.|..|:..|..|....|:.|::...:|...
Zfish 14782 VLPSCDLRDLPNLNYIAK------------EGSNVRLKIPIIGKPTPAVSWKKGEDENLTDTGRV 14834

  Fly 14277 -IEDKPVEK---ISEYSEVDSDEPKLTVAVKEFIPEKPEEKPFEIVVLEETVESKREPDEEGKVR 14337
             :|...|..   |.:....|:.  |.|:.::.....|      |..:....|.....|:...|.:
Zfish 14835 CVESTAVNTTLLIRDCQRTDAS--KYTITLRNSAGTK------ESTIFVRVVGKPGIPNGPIKFK 14891

  Fly 14338 EKVVKTKKIK----QNRGSVEVVHDIVEEIDTDTNESVITVTTTVPTETPDQDQPSVKQKRTKKI 14398
            |.......:|    ::.|..||::.|:|:.|:.|| ..:||:::|.|.:            .:..
Zfish 14892 EVTADGATLKWSAPKDDGGSEVINYILEKRDSITN-MWVTVSSSVVTNS------------FRVT 14943

  Fly 14399 KKDEVEDFVKRVIEE-----------------------EAPQPEGSV----DLVVIEDFVPKPSS 14436
            ...|..:::.||..|                       ::|.|...:    |...:..|.|:.:.
Zfish 14944 GLHEGTEYIFRVSAENKYGIGEGLKSEPMVAKHPFNVPDSPPPPQVMSMRHDSATLTWFDPRKTG 15008

  Fly 14437 -------------------EKRKKKPIK---DKHTSVEEETPHEDEVLLIE--SVPEDSPLSDDL 14477
                               ::....|:|   .|.|.:.|...:|..|:.|.  .|...||.::.|
Zfish 15009 GSPITGYHVEFKERNSMLWKRANSAPLKMRDFKVTGLTEGLEYEFRVMAINLAGVGRPSPPTEPL 15073

  Fly 14478 ITVVDSVPIEEEPE----NKVNQIEDTKKPEKKKKPKPSAKILEEN-------VPEDTVEKPLEA 14531
            : .:|::....:|:    .:........:|:.....:.:..|:|..       |..:|| ..::.
Zfish 15074 V-ALDAIDAPGKPDVICITRSTVTLQWTEPQYDGGHRLTGYIVERRDLPAKVWVKANTV-NVIDC 15136

  Fly 14532 LHTDSDLEKPDVQEFSISIKEEEQKHTHPEKKKSSKISSEQPKQPSTEQYEISVTEHDLKPEEEK 14596
            .:|.:||::....||.|..|......:.|.::..:.:.:::...|:.          .:.|..::
Zfish 15137 AYTVADLQEGCKYEFRIRAKNAAGAISQPSEQTDTLMCTDEYAAPTI----------IIDPTVKE 15191

  Fly 14597 PFTVQ----VIQSETNVEETKDDT------GKVHK-----QVTT---------KRMLRRPAGEGE 14637
            ..||:    ::.:.|::......|      ||..|     |:.|         |...|:.:||..
Zfish 15192 GLTVKSGDTIVITATSILGKPQPTSVWSKGGKYFKPSDVCQIETTPSSSTLFIKYASRKDSGEYT 15256

  Fly 14638 IEIIEVVRDDQPEAEITIVEY--EPEPVNQDEKPKEPKKKTRKVKKDD----IHDYIQKLIELET 14696
            |.........:...::||::.  .|.||.......|....|.....:|    |..||        
Zfish 15257 ITASNPFGVKEENVKVTILDVPGPPGPVEASGISSEKVTLTWTAPHEDGGSPIKSYI-------- 15313

  Fly 14697 PKTELEKYEKIEFEPIVKDKPLDSPIDVLDESPKEVQKKDKKSRSTKVPNEETPVQEQYAKVNVV 14761
                   .||.|...::.....::.||....:.|.:|..:...|.:.|.|...........|.:|
Zfish 15314 -------LEKRETSRLLWTILAENVIDCHFVANKLIQGNEYIFRVSAVNNSGAGDASHSGPVKMV 15371

  Fly 14762 EEEAPEQPEIPVQILEVKPVEVDVKEVITEDGKPVQEKTTKRVLKKIGPEEQTTFKITMIESEDN 14826
            :...|..|          |.:.:|:.|.                                    .
Zfish 15372 DSYGPPGP----------PAKPEVENVA------------------------------------G 15390

  Fly 14827 DSVTVIVDEEPEIASPQSIEEHPEQSKEKLAPKPKKTVRKVKKD--DLSDYVKKL---IEEEIPK 14886
            :||| |..:.|.......|..:..:.|||   |..:..|..||.  ||...||.|   :|.|. :
Zfish 15391 NSVT-IAWKRPADDGGSDITGYMVEKKEK---KGMRWTRASKKTIADLHFEVKGLKEGVEYEF-R 15450

  Fly 14887 VDLEKYEKVEMPEKPVKLTVSDSIPEEPKPDKSQPISVLPDTTKPKKTKTPKTP----------- 14940
            |..|.......|.:|....::..:...|.|    |::       |:.|.|.||.           
Zfish 15451 VAAENKAGFGEPSEPSIPVMTKLVAYVPAP----PVN-------PRVTDTTKTTAELHWGKPLSD 15504

  Fly 14941 ------------KTEDTDQQVPD----------------------------------EPTETT-- 14957
                        |.|..::.:.|                                  ||.:|.  
Zfish 15505 GGMEVTGYFVEHKKEGEEEWIKDTSVPLRITEFVVPNLEAGLKYHFRISAMNAMGVGEPAQTADA 15569

  Fly 14958 ---VDTTDIPEL----------------------------TPTQTAQPEDTA------------- 14978
               |:..:||:|                            |||.|...||:.             
Zfish 15570 VQIVEREEIPDLELDVELRRTLVVRAGASIRIFIPIKGRPTPTVTWTKEDSPLKTRAIIDNTESY 15634

  Fly 14979 TAQITPSAQEEKSTQDDTKDTIQKTVKHKKTKPDTQKSVETSELPEVHKDYQISIIHEELVEEEQ 15043
            |..:.|......:.:.|.      |:::...|..|...|...:.|....:.:.:.|.:|.:    
Zfish 15635 TLLVIPDCNRRDAGKYDL------TLENAAGKKTTSVVVRVLDSPGPPLNLKTTAIDKESI---- 15689

  Fly 15044 PEKILEVRVIDEVAEVEESQPIVEEVEDEEPQPATEETVEDVTKPKSKKKKVVKKKTDDHDELIK 15108
             ....|:.:||..|::  :..|:|:.|......|...|       |.:|..|   :..|..|   
Zfish 15690 -TLAWEMPLIDGGAKI--TNYIIEKRESTRKAYAAVIT-------KCEKCSV---RVSDLGE--- 15738

  Fly 15109 KMLEQEIEKTELEKYEKIEFDVPKKLKPEFAALEPIKIERKEQKPTKVTILDATDVPK-TVKLKP 15172
                      .||.|.::..:....:.......:||::.:....|..|||   |||.| ||.|..
Zfish 15739 ----------GLEYYFRVSAENEYGIGEAVETPDPIRVSQAPTPPENVTI---TDVTKHTVGLTW 15790

  Fly 15173 SKRKEKPAEELTVQLPKFRLKARMVLVEYPPAPLIPKTTD----IGAIKDNGELSRNIEEAEEIL 15233
            :|.|......:|    .:.::|:            .|.||    :..||:.....:|:.|.||.:
Zfish 15791 TKPKHDGGSRVT----GYVIEAQ------------KKGTDQWSHVTTIKNLDLTVKNLNENEEYV 15839

  Fly 15234 ----------KFKPHKTKKIKKIKDDLEKVELEKYEKYISSEEEPE-------EKTPYKKPEK-- 15279
                      :..|..:|.: .|::               ...|||       :||...|..:  
Zfish 15840 FRVMAVNSSGRSHPRVSKHV-VIRE---------------QNSEPEFDLRGVCQKTVIAKAGENI 15888

  Fly 15280 --------APKP--EEKQEDVKLKLGKGKKKPKEEEAPENV----------------TLKNIPQK 15318
                    .|||  ..::::..|||  .::...|..|..|:                |.|||   
Zfish 15889 KVEVPVSGRPKPTVSWQKDNQALKL--TQRTMIENTATSNILIINECLRSDSGIYSMTGKNI--- 15948

  Fly 15319 PQEVEEEVELKQKPKEVEIVEEQTKKPKDGEFVVEPFEPSEFDRPE---------YVPD------ 15368
            ...|.|.:.:|     |..|....|.|...:.:...|....::.||         ||.:      
Zfish 15949 VGSVTENITVK-----VHDVPGPPKGPIKLDKITRTFIEFSWETPENDGGVPINNYVVEIRETTS 16008

  Fly 15369 ----ELEQIEHPEIPEKVKKPSKTKYKPKDKSKSEPET---IVSE-IVAGVPKEEEAIPEQDVKF 15425
                ||..:......:..:..:..:|:.:.::|:...|   |.|| :||..|            |
Zfish 16009 QSWVELSSLIIRTTFKATRLTTGVEYQFRVRAKNRYGTGPPITSEAVVAAYP------------F 16061

  Fly 15426 RKPERDAPEETDSEIKLRPVPQASKD------ENPDEQALVTPKAEEPIPQEIEDKAIDDEKKPK 15484
            :.|   .|..|...:..      :||      ..|     |:....|.|...:|.|..:.....:
Zfish 16062 KAP---GPPGTPKVVAF------TKDTMTIGWNEP-----VSDGGSEVIGYYVERKERNSIVWHR 16112

  Fly 15485 KSKPKKVQPKEQEIAKEEPEEFEVSV-KEEEALVDKPIEIEKP---KDVKVKEKKPKEAPVSEVV 15545
            .||...|....:....|:...:|..| .|..|.:.||.:..:|   .|......:|....||:..
Zfish 16113 ISKTMVVGNLFKSTGLEDGVAYEFRVFAENIAGIGKPSKASEPLLALDPVDPPGQPVPVLVSKNA 16177

  Fly 15546 VIEEEPKPEEVPEEIPVEYKITTTVLEPEDAPKEHQVKVIDFDERQETT--------EEVIEEKV 15602
            :..:..||     |....:|||...:|..|.|....:|. :|....|||        |...|.:|
Zfish 16178 ITIQWTKP-----EYDGGFKITGYTVEKRDLPAGRWMKA-NFTNIIETTFTISGLTQEASYEFRV 16236

  Fly 15603 VTRKKKPKPQQPEEFEVTLKEPKEEQI-QPDVVSAEISLPIEEPEQKPEQYEVELKITQTTPEEP 15666
            :.|........|       .||.:..| :.|||...|.:                          
Zfish 16237 IARNSAGAVSNP-------SEPSDPIICKDDVVEPRIMV-------------------------- 16268

  Fly 15667 NDVQIAVKEKVKTKPVKKVKEDKIVVVEAEEEKQPVEETIVEVEKQEEKKKSEKPKSYEFKISET 15731
                     ..|.|.|..||..::..:||:...||:...:    ..::.|..|.....:.|::|.
Zfish 16269 ---------DAKFKDVVLVKAGELFKLEADVAGQPLPSMV----WTKDGKDVENTSKLQIKMTEL 16320

  Fly 15732 QSIEEKPIEVAEEAPEETPKVVEKKVAEKFDSYEFTLKETDEEKVITVDDQPEEEAPVEVVFKKK 15796
                             |..::.|....| |..||.|..|:      |....:....|:|:  .:
Zfish 16321 -----------------TAALINKDSIRK-DGGEFILTATN------VGGFAKHVFNVKVL--DR 16359

  Fly 15797 PKEPEAVEAEFVMTEPKIVEETSVETAIKQKKTKKPKKDEEEAQLAIKVVESEAPVAEEVFSEAP 15861
            |..|:.         |..|.:.:.|..:   .|.||..|:..|.:...|:|..........:.|.
Zfish 16360 PGPPQG---------PLAVSDITAEKCV---LTWKPPTDDGGANIEQYVIEKRESSRLAWTNVAS 16412

  Fly 15862 ESKIVEEEVIAEEKPKEFTIRVS-----------ESEP-----------KPEEPSVEQFT----- 15899
            |.::.:.:|....|..|:..||.           |||.           .|:.|.:...|     
Zfish 16413 ELQVNQYQVTKLLKGNEYIFRVMAVNKYGVGEPIESEAIIAENPYLPPGPPQTPEITAVTKDSVV 16477

  Fly 15900 -----------------------------VKKRKPSVT-------------------FADEPATE 15916
                                         ||..|..||                   ||:..|. 
Zfish 16478 ICWGAPASNGGSEITNYRIERRDRISLRWVKCNKKKVTDLHFKITALVPGHEYEFRVFAENAAG- 16541

  Fly 15917 IVIKESKPAE--VVTEDAHIKTKKP-KKKVTDVEAEELKI-----------KITEEVPQE-IPIL 15966
              |.|..|:.  |...||..|...| ..::.|..:..:.:           :||..:.:. ||..
Zfish 16542 --ISEPSPSSPFVKATDALFKPGPPGNPRILDTTSSSITLAWNKPIYDGGSEITGYMVETCIPGT 16604

  Fly 15967 EE-----VSEEEVITETKKT-APVVEEKTYKIGIKETEPEKPAEAIVEEEEPVVTEPIEEAPKPE 16025
            ||     ||.::.:..|..| ..:.|.:.|||.:.....|...||          .|:..:||. 
Zfish 16605 EEEEWTIVSPKDGVKGTSFTITNLKENQEYKINVSALNSEGVGEA----------APVPGSPKA- 16658

  Fly 16026 VFEEHKVRVIEETPRELVEEVIEEEVKVIR-----RKKPKPEIK-----EEPEAEVTVSTPK--- 16077
              ||..:....:...:|.:.|.......:|     :.:|.||:|     :||....|:.|..   
Zfish 16659 --EERLIAPEADLDADLRKIVNIRACNTLRLFVPIKGRPTPEVKWSRENDEPLDRATIETTSSFT 16721

  Fly 16078 -----------------PVEEVEATSSIAVIPEQPTEEEAADLKITIIEEETPPQEL-VQEI--E 16122
                             .||....|.:::||             :.:::....||.| :.::  |
Zfish 16722 SLVVGNVNRFDSGKYNLTVENSSGTKTVSVI-------------VRVLDTPGAPQNLKISQVTKE 16773

  Fly 16123 EIEIVEEPK------------APEEQPTDFTFATKDS---EKKPTVEELPE-------------- 16158
            .:.::.:|.            ..:.:.|...:||.:|   :...||::|.|              
Zfish 16774 SVSLIWDPPINDGGTKIKNYIVEKREATRKAYATVNSNCHKTNWTVDQLQEGCNYYFRVLAENEY 16838

  Fly 16159 ---------EQVTIQKKKKKAPVPEVVEEPEAEFLVKPKTPVQEVTEEAKITKSKKPVKEEEAAA 16214
                     |.|.:.:|    |:|            ..|..:|:||:.......:||..:..:..
Zfish 16839 GIGLPIETGESVKVSEK----PLP------------PGKITLQDVTKTTVTLSWEKPEHDGGSRV 16887

  Fly 16215 ELKVTITEEIPTEPEVQEIIEEIEE--IEEEKPA-EYVIEVKESQPEAVED-KEVSLP---KKKP 16272
            ...|...:...:|...|.:|.::.|  |....|. ||:..|.....:...| :::.:|   |...
Zfish 16888 VAYVVEMQSKGSEKWSQAVIVKVPEAVISGLSPGEEYMFRVSARNEKGTSDPRQIGVPVIAKDLV 16952

  Fly 16273 KAPIVEEPEAEITL--------------KPKVKSEEVQEEAKIVKKKPKKIDEVAVADELTVKVE 16323
            .||.|:...:..|:              :||.....:::...:  |:..:::..:...||.:.::
Zfish 16953 IAPSVKMLFSTFTVLAGEDLTIDIPYNARPKATISWIKDAVPL--KRTTRVNFSSTDKELNLVIK 17015

  Fly 16324 EEVVPEPIVEEEVIEEFEIKKKPKEPEPEDIVDAAIVKLKKP----EPVDADEVVAEVTLKPKAK 16384
            |..       .:.:.::.||.  .....|..||..||.|.||    .||:.|             
Zfish 17016 EAC-------RDDVGQYSIKL--SNTAGETTVDIGIVVLDKPGPPTGPVNVD------------- 17058

  Fly 16385 TEVTEEEFSVDVKLPK------------EKKVTEETSDQTV-------QLKKKKKPQKPVEEAAD 16430
             |||.:..:|..|.|:            ||:.|..|:.|.|       |:|            |.
Zfish 17059 -EVTSDSITVSWKPPEYDGGCTINNYIVEKRDTSTTNWQIVAGNLARTQIK------------AG 17110

  Fly 16431 ELKLQ-----QTVVEER----PVEIEEEEIIEEAVVIRKKPKKPF--------------EPTVED 16472
            .||..     :...|.|    |:.:.|..:.:....:...|..||              ||.::.
Zfish 17111 RLKTGSEYQFRISAENRYGKSPILVSECIVAQYPYKLPGPPGTPFLQSSTKDSMIIVWNEPVIDG 17175

  Fly 16473 --------------------------LEETEFSLSFKKPHTINEGVEEAATV------------- 16498
                                      :::|.:     |...:.||:|....|             
Zfish 17176 GCTILGYHLERKERNSILWMKLNKSLIQDTTY-----KTTGLEEGMEYEYRVYAENIVGTGKASK 17235

  Fly 16499 -----LKKRPVKPTTLDEAAA----ELSIKRQEEEYEEGEDIEEFVVSQQRKP----KPLQITEE 16550
                 :.:.|..|....||..    .::|...:.||:.|..:..::|.::..|    .....|..
Zfish 17236 LSEGFVARDPCDPPGTPEALTITKNSITIVWTKPEYDGGSKVTGYIVEKKELPAGRWMKANFTNV 17300

  Fly 16551 DEEAYTVKKLKRRKQVDI-------------PEYA--------DVE--NVTFRARSTKT------ 16586
            .|..||...|...::.:.             |.|:        ::|  .::.....|:|      
Zfish 17301 IETEYTATGLTENEKYEFRVIARNAAGVFSDPSYSTGPIMAKDEIEPPRISINPEYTQTIVVNAG 17365

  Fly 16587 ---KEDVD---------------QEFNIAL-------DSYA-----EEEISMSGKVKLKKPIKKT 16621
               |.|.|               ||....:       |||.     |.:::..|:..|.  ::..
Zfish 17366 DNFKIDADVHGKPIPTISWQKGEQELGNTIYREIKSTDSYTCLTVKEAKLADGGQYTLL--LQNP 17428

  Fly 16622 FSEAADEAKIKIIQDFDDGEEPI----------------------------IEEIRDDEDTIDEV 16658
            ..|.|.:..|.::......|.||                            |.|.|:....:..|
Zfish 17429 GGEKAVQVNICVLDKPGAPEGPISITGVTNEQCCLAWKPPKQDGGSKITHYIVERRETSRLLWTV 17493

  Fly 16659 EEPE---------------EYFV-----------EELPPDEVDFK--LKPKKHPKPAYSVQDEEE 16695
            .||:               ||..           |.|....|..|  ..|...|| ...|.:.::
Zfish 17494 VEPKVQAVSLKITKLLEGNEYIFRVLAVNKFGVGEPLQSGAVVIKNPFTPPDAPK-GLEVSNVKK 17557

  Fly 16696 EQFLIGIRHPKRDSVT---------YDED-------------SLTFKKKRKVVQQLFNEDGASLN 16738
            :..::....|..|..|         :|::             :||||....:...|:....::.|
Zfish 17558 DSMVLTWEAPTNDGGTTITGYIIEKHDKEGVRWTRCNMKSVTNLTFKVTSLMENHLYEFRVSAEN 17622

  Fly 16739 ITREMNVEESENLNIMYSICNYI-----ADNNEAINLVEGEKVTVVGRHSSE-----WWYV---- 16789
            ..   .|.|:.:..:.|...:.:     ..|.:.:::.:...|...|:...:     ..||    
Zfish 17623 AA---GVSEASSATVFYKALDPVFKPGPPHNPKVLDMTKSSVVLAWGKPIYDGGCEIQGYVVEAC 17684

  Fly 16790 -------KKSTTEEEG---------WV-------------PAQYLMEPEEYAQYVQNKLHEKIDK 16825
                   :..|:.|||         |.             ..:.|.|.:||...|.     .::|
Zfish 17685 EARAAPEETKTSVEEGKAAEEIQEQWTMCTPPTGVKLTRFTVENLKEKQEYKFRVC-----AVNK 17744

  Fly 16826 LPVFERPG------PEDKPIAPRF-----IEKLQPIHTPDGYTVQFECKVEGNPRPQIAWFRETA 16879
            |.|.|...      ||||...|..     ..||  :....|.:::.....:|.|.|||.|.::..
Zfish 17745 LGVGEHADVAGPICPEDKTEEPDLDIDAEFRKL--VRIKAGGSLRMFIPFKGRPTPQIKWEKDGE 17807

  Fly 16880 IIKPSQDFQMFYDDDNVATLIIREVFPEDAGQFTVVAKNAAGFTSSTTEL-IVESPLSDHGSDAT 16943
            .||.|...:   ...:..:|:|.:|...::|::||.|:|:.|..|.|..: ::::|.:.......
Zfish 17808 QIKESAQIE---TSSSYTSLVIDKVSRVNSGKYTVTAENSTGAKSETIMVKVLDTPSAPLNFKVK 17869

  Fly 16944 ALSRRSMSRESSLADILEGIPPTFSKKPKAQ-YVDENTN--------VILEC------------- 16986
            .:::.|::        |...||:.....|.: |:.|...        |:..|             
Zfish 17870 EITKESVT--------LTWEPPSLDGGAKIKNYIIEKRESTRKTFAAVVTNCHKLSWKVEPLQEG 17926

  Fly 16987 -----RLVAVPE------------------PDIVWTFNGEDIDEEEIKNVRIVTESDMH------ 17022
                 |::|..|                  |......:..|:.:   .:|.:..|..:|      
Zfish 17927 CSYYFRVLAENEHGVGLPADIADPLKISEVPQCPGKLSVVDVTK---TSVSLSWEKPIHDGGSRI 17988

  Fly 17023 -MY--------------CSVVH-----ISKVKKSQEGTYEVIATNREGEARLPITLKVRTTDKE- 17066
             .|              |:.|.     ||.:...:|.|:.|||.|.:|::. |.||.|....|: 
Zfish 17989 LQYLVEMQVKGNEKWSGCANVKTLEAVISNLNPGEEYTFRVIAVNEKGKSD-PRTLAVPVQAKDL 18052

  Fly 17067 --APQILEPLRNMVIREGESVVLSTQIVGNPPPKVTWYKDGKPVK-----NAKSDKDLHTLTLIT 17124
              .|.......:..:..|:.:.:...:.|.|.|||.|.|||..:|     |..:......|::..
Zfish 18053 VFGPDARPTFSSYSVLVGKDLQVEIPVFGRPKPKVQWTKDGAALKFTTRVNISNTARSTVLSIKE 18117

  Fly 17125 PQKSEKGEYTVKAVNPLGSVETTAN-LTIEEPAGGNAEPPLFVERFEEQNVPQKGEIRLPAKVSG 17188
            ..:.:.|.|.:...|.:|..:.|.. :|:::|.     ||....||:|..|........|.|.:|
Zfish 18118 AAREDGGMYGINVSNAVGQKDATIEIITLDKPG-----PPTGPVRFDEVTVTSVTLSWDPPKFTG 18177

  Fly 17189 N-PVPEVQWLFNNTPLFPSERIQQVYD-----GENIEL-----IIKDANPETDSG-DYKCIASNP 17241
            . |:              |..|.|..|     .||:.:     .:|....:|.:. .::.||.|.
Zfish 18178 GCPI--------------SNYIVQKRDTTTTTWENVAISLARTTLKVLRLKTGAEYQFRIIAQNR 18228

  Fly 17242 IGKT-----------------------------------------SHGARVIV-------EVDEV 17258
            .||:                                         |.|...|:       |.:.:
Zfish 18229 YGKSYALDSSAVVIQYPYREPGPPGTPFVSCLSKDHMIVEWHEPVSDGGSSIIGYHLERKERNSI 18293

  Fly 17259 TFTKKLKKTITIEEVQSLT--LE--------------------------------CE-------- 17281
            .:| |:.||: |:|.|..|  ||                                |:        
Zfish 18294 LWT-KINKTL-IQETQFKTGPLEEGIEYEFRVYAENIVGIGRCSKISEGFVARDPCDPPGTPEAV 18356

  Fly 17282 --TSHVVTTKW----FFNGKELSG--MDHRVVVEDGKTHKLVIRN--------TNLRDSGTYTCK 17330
              :.:.:|.:|    :..|..::|  ::.|.:.| |:..|....|        |.|.:...|..:
Zfish 18357 RVSKNAITIQWTKPEYDGGSVITGYTVEKRDLPE-GRWMKASFTNVIETDFTVTGLTEGAKYDFR 18420

  Fly 17331 VKKQETQSTVEVLQRKPDF----IKVLEDYE---------------VTEKDTAILDVELTTE-AT 17375
            |..:....|:.    ||.:    |..|::.|               |...||..||.::..: ..
Zfish 18421 VIAKNAVGTIS----KPSYNSGPIAALDEVEPPKFSIDPEYTQALVVNAGDTFKLDADVHGKPVP 18481

  Fly 17376 EVTWYKDGEKITPENKNVEFIKDGKARRLVI-RDVTIHDEGQYTCKIE----GQECSCELVVIEL 17435
            .:.|:|:.:::  ||.....||:...|.|:| :|....|.|.|..::.    .|.....:.|::.
Zfish 18482 TIQWFKNDKEL--ENTIRCDIKNTDNRALIIVKDAVRQDGGNYILQLNNIAGSQTVQFSVKVLDK 18544

  Fly 17436 PPEIVEPLNDVAVTK-------------GENAVFEVELSKGD-ALVKWFKNGKEIVFNE------ 17480
            |.....||....|:.             |.|.:....:.:.: :.:.|     .:|.|:      
Zfish 18545 PGPPEGPLRVTGVSSDKCTLIWRPPLDDGGNTITHYIIERRETSRLAW-----AVVCNDCKTTTY 18604

  Fly 17481 RIQLAIDGKKQSLRIVKAKPEDVGE----------------YSVQVGEQTSKAK--LTV------ 17521
            ::...::|.:...|::.|....:||                .|.|:.|.|:.||  :||      
Zfish 18605 KVTKLLEGNEYIFRVMAANSYGIGEPIDAPSIIMKDPFIHPGSPQIIEVTNIAKDSMTVCWSAPD 18669

  Fly 17522 ---EEPLVDFVIRLPDIT-------LATKTTDAEFTVQ-------------------LSQPDVEV 17557
               ...::.::|...|.:       ...|.||..|.|.                   :.:|.:..
Zfish 18670 SDGGSEIIGYIIEKRDRSGIRWTRCNRQKVTDVCFRVHGLIEDHEYEFRVSAENASGIGEPSLPT 18734

  Fly 17558 TWCKKGKP-IKPNQKHEVFVEGTVRRLV---------------------IHDASDED-------A 17593
            ::.|...| .||.......|..|.:..:                     |..|.:|:       .
Zfish 18735 SYYKACDPKYKPGSPMHANVVDTTKNSITVAWGKPLNDGGCAIQGYIVEICKAEEEEWTMCTPPT 18799

  Fly 17594 G------EISCVAENVTSSTKLCV-------------------EELKLPPV-ITSDKDQTIKVKE 17632
            |      ||:.:.|......::|.                   ::|:.|.: :.|:..:.|.|:.
Zfish 18800 GLRVNKFEITKLVEQQEYKIQICAINKLGVGEPVVIPGTVKPEDKLETPEIHLDSELRKGIVVRA 18864

  Fly 17633 NDDVTFTVKYTGVPTPEACWTTRKVVIPKSKRTIPTIDEQSAKLTIKKVVDDDEGEYTVKLVNPV 17697
            ...|...|.:.|.|||:..||..:..:  |::|:.........|:|......|.|:|||.|.|..
Zfish 18865 GGSVRINVPFRGRPTPDIKWTKDEGEL--SEKTVLEKGLNFTHLSIDSCDRRDSGKYTVTLQNSS 18927

  Fly 17698 GEAEASLHLVIMRKPTAPGTPQPLEIMHDSITLYWKAPEDDGKSEIIEYILEYQDVKEEKWTEI- 17761
            |.....:.:.::..|.||......:|..||:||.|:.|..||.::|..|:::.::...:.:..: 
Zfish 18928 GSVSEFVTVKVLDTPGAPLNLVVKDIKKDSVTLVWEPPLIDGGAKIKNYVVDKRESTRKAYANVT 18992

  Fly 17762 RKIKDTTYTISKLKIDTEYVFRSIAVNEVGPSPPSPLSPPIRLVPKVETKAPSVQEPLQDVVSEL 17826
            .|...|||.:..|.....|.||.:|.||.|...|        :..|..:||..|..|::.|:...
Zfish 18993 TKCSKTTYKVENLAEGAMYYFRVMAENEYGVGVP--------VETKTASKASEVPLPVRKVMLTD 19049

  Fly 17827 DKEVTLSCVFGGIPEPKVTWKK---NGQVFESRSIRYENRVAKYTIE-----------KTTIET- 17876
            ..:::.|          :.|.|   :|          .:|:|.|.||           .|.::| 
Zfish 19050 VTKISAS----------LAWDKPEDDG----------GSRIAGYLIEMQPKGTDKWGVATNVKTC 19094

  Fly 17877 EATYT-----------CVATNEKGSAETSCRLKLQQKPV----LEVED----KYLTQKLRTGSIL 17922
            |.|.|           .:|.||||.:|.    |....||    |.:|.    ::.|..:::|...
Zfish 19095 EGTVTGLTSGHEYLFRVLAYNEKGKSEP----KPLAAPVIANDLTIEPSLKLQFNTYSVKSGKDF 19155

  Fly 17923 TIPATVRGYPQPTVTWHKETIEQKTTKSVTIETTETTSTYTVKKVTREQSGKYKVTATNESGTTY 17987
            .:...:.|.|:|.:||.|:..:.|.|..||...|.|::...:.:..::..|||.|||||......
Zfish 19156 KLEIPIFGRPKPKITWSKDGQQLKVTSRVTTSNTPTSTILQITEACKDDLGKYAVTATNSVCAIT 19220

  Fly 17988 VECTVQVIDKPSRPQS-LEIKDIKKDSIVLEWTPPVDDGGLDIEKYTLEKCDVQNNVWMKVSDFN 18051
            .:..:.::|||..|.. :::.::..:|:.:.|.||...||..::.|.:||.|...:.|..|:. :
Zfish 19221 EDINIVILDKPGPPTGPIKVNEVSNNSVSISWEPPEYTGGCQVKHYIVEKRDTTESTWQTVAG-S 19284

  Fly 18052 KDIKSYAVQKLSMNAQYMFRVVAANPIGESEPTESDPVTITKKFEKPSPPRGPTTVSGMNDTSFN 18116
            ....|..|.||...|:|.|||||.|..|:..|.:|..:.:...::.|.||..|...|...| ...
Zfish 19285 VARTSLKVTKLKTGAEYQFRVVAENRYGKGAPLDSKSIVVQYPYKPPGPPGTPYVKSATKD-QMT 19348

  Fly 18117 LAWEPSETDGGSKIIEYIVEIREETETTYRSVGVTLGTVTNIHVEKVVRNKGYFFRIYARNEVGT 18181
            :.|.....||||.:|.|.:|.:|.|...:..:..||.|.|...:..:....||.||:||.|.||.
Zfish 19349 IEWNEPVIDGGSSVIGYHLESKERTSILWTKLNKTLITDTVFKICNLEEGIGYEFRVYAENIVGI 19413

  Fly 18182 SEAFETTEKIVL-------------------------------GRKIT----------------- 18198
            ..|.:.:|..|.                               |.|:|                 
Zfish 19414 GRASKVSESFVARDPCDPPGTPEAVAISKDHIKIQWTKPQYDGGSKVTGYIVERRDLPEGRWMRA 19478

  Fly 18199 ----------------------------------------------------------------- 18198
                                                                             
Zfish 19479 NFTNVIETEFTVTGITVNNQYEFRVIARNAVGVFSEPSDSTGPITATDEIEPPSVSMDPKYKDVI 19543

  Fly 18199 ----NDN---------------------------------------------------------- 18201
                .||                                                          
Zfish 19544 VVNAGDNLVLDADIHGKPTPDIQWLKEGKEMDKTLRIERRSTQKYASITIKDCTRLDGGHYDLIL 19608

  Fly 18202 -------------EALAPPSPPQN-LRAPDVTSRSVTLDWEVPARNGGSEITGYCVEKRSSTSTN 18252
                         :.|..|.||.. ||...:.|....|.|..|::|||:.|:.|.:||:.::..:
Zfish 19609 SNSGGTKTVPIAVKVLDRPGPPTGPLRVAGIMSDKCHLSWSEPSQNGGANISHYILEKKDTSRLS 19673

  Fly 18253 WTKVITLDAHQLHYTIDNLKEKCEYWFRVSAENEVGLGAPAVTESISLKTHATVPSPPTGPLEAR 18317
            || |:..:...:.|.:..|....||.|||.|.|:.|:|.|..:|:|:.:.....||.|:.| ||.
Zfish 19674 WT-VVDSNIPTVTYKVTKLLSGDEYIFRVMAVNKYGIGEPLFSEAITARNPYKPPSAPSAP-EAS 19736

  Fly 18318 VLAANAHIFEWGLPESDGGAPLLGYHIAIRDMKKTMWIEVGRVPAGVLKFQIRDLQENHEYMIRI 18382
            .:..::....|..|||||||.:..||:..||.....|.:..|.....|.|::..|.|.|.|..|:
Zfish 19737 EITKDSITLSWNAPESDGGAEITCYHLEKRDKDGVRWTKCNRQKLTDLHFKVTGLSEGHFYEFRV 19801

  Fly 18383 FAKNEIGLSEPLESEEPYKAMTA-GHESLPDEPR-TEMSSCNTS-SWLRDHHMDADIHSYARGRL 18444
            .|:||.|:.|..:....|:|:.| .....|..|: |:.||.:.| ||.:.   .:|..:|.:|.:
Zfish 19802 SAENETGVGECSDLSLFYRAINATTPPGPPHHPKVTDYSSSSVSLSWAKP---ASDGGAYIKGYI 19863

  Fly 18445 LQRDEYFFRLW 18455
            ::..|.....|
Zfish 19864 VEMKEVSSEEW 19874

Known Domains:


GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:254352 30/87 (34%)
Ig 109..175 CDD:143165 26/66 (39%)
Ig 254..334 CDD:299845 23/81 (28%)
I-set 255..344 CDD:254352 28/90 (31%)
I-set 372..462 CDD:254352 34/90 (38%)
Ig 390..463 CDD:299845 30/73 (41%)
Ig 471..561 CDD:299845 33/92 (36%)
I-set 471..560 CDD:254352 32/91 (35%)
I-set 618..709 CDD:254352 39/91 (43%)
Ig 645..705 CDD:143165 28/60 (47%)
DUF1136 715..741 CDD:284093 5/28 (18%)
IG_like 762..843 CDD:214653 24/81 (30%)
Ig 779..835 CDD:143165 19/56 (34%)
I-set 890..982 CDD:254352 20/94 (21%)
Ig 918..979 CDD:143165 10/62 (16%)
DUF1136 988..1014 CDD:284093 5/33 (15%)
I-set 1024..1116 CDD:254352 30/106 (28%)
Ig 1058..1113 CDD:143165 18/56 (32%)
I-set 1158..1250 CDD:254352 20/102 (20%)
Ig 1178..1246 CDD:143165 16/68 (24%)
DUF1136 1256..1282 CDD:284093 7/53 (13%)
I-set 1291..1380 CDD:254352 18/91 (20%)
IGc2 1304..1372 CDD:197706 16/70 (23%)
DUF1136 1388..1414 CDD:284093 3/26 (12%)
I-set 1424..1515 CDD:254352 27/91 (30%)
Ig 1442..1513 CDD:143165 20/71 (28%)
DUF1136 1522..1548 CDD:284093 4/26 (15%)
I-set 1558..1645 CDD:254352 14/87 (16%)
IGc2 1571..1639 CDD:197706 14/68 (21%)
DUF1136 1655..1679 CDD:284093 2/24 (8%)
I-set 1691..1782 CDD:254352 22/91 (24%)
IGc2 1718..1772 CDD:197706 13/54 (24%)
DUF1136 1788..1814 CDD:284093 6/26 (23%)
I-set 1824..1916 CDD:254352 17/92 (18%)
IGc2 1838..1906 CDD:197706 12/68 (18%)
DUF1136 1922..1948 CDD:284093 2/26 (8%)
I-set 1958..2049 CDD:254352 16/91 (18%)
Ig 1985..2044 CDD:143165 11/59 (19%)
I-set 2089..2181 CDD:254352 26/100 (26%)
IGc2 2103..2171 CDD:197706 20/76 (26%)
DUF1136 2187..2213 CDD:284093 6/26 (23%)
I-set 2222..2314 CDD:254352 23/93 (25%)
IGc2 2236..2304 CDD:197706 19/69 (28%)
DUF1136 2320..2346 CDD:284093 3/26 (12%)
I-set 2356..2448 CDD:254352 23/92 (25%)
Ig 2384..2445 CDD:143165 18/61 (30%)
DUF1136 2454..2480 CDD:284093 0/26 (0%)
I-set 2488..2580 CDD:254352 23/98 (23%)
Ig 2516..2576 CDD:143165 16/66 (24%)
I-set 2622..2714 CDD:254352 26/98 (27%)
IGc2 2636..2704 CDD:197706 18/74 (24%)
I-set 2754..2844 CDD:254352 30/116 (26%)
Ig 2771..2840 CDD:143165 22/95 (23%)
IGc2 2908..2974 CDD:197706 17/68 (25%)
I-set 3029..3120 CDD:254352 23/95 (24%)
Ig 3057..3116 CDD:143165 14/59 (24%)
I-set 3130..3220 CDD:254352 26/90 (29%)
Ig 3148..3219 CDD:143165 21/71 (30%)
I-set 3263..3354 CDD:254352 21/92 (23%)
I-set 3401..3493 CDD:254352 30/93 (32%)
Ig 3429..3490 CDD:143165 22/62 (35%)
I-set 3539..3630 CDD:254352 20/91 (22%)
Ig 3556..3625 CDD:143165 13/69 (19%)
I-set 3676..3767 CDD:254352 11/91 (12%)
IGc2 3690..3758 CDD:197706 7/68 (10%)
I-set 3811..3900 CDD:254352 23/90 (26%)
Ig 3828..3899 CDD:143165 20/72 (28%)
I-set 3954..4046 CDD:254352 27/102 (26%)
Ig 3963..4042 CDD:299845 23/88 (26%)
I-set 4092..4180 CDD:254352 15/88 (17%)
Ig 4102..4172 CDD:299845 11/70 (16%)
I-set 4394..4483 CDD:254352 20/89 (22%)
Ig 4411..4480 CDD:143165 20/69 (29%)
I-set 4497..4581 CDD:254352 25/90 (28%)
Ig 4519..4580 CDD:143165 20/67 (30%)
I-set 4604..4693 CDD:254352 30/99 (30%)
Ig 4621..4691 CDD:299845 25/78 (32%)
I-set 4702..4792 CDD:254352 12/92 (13%)
Ig 4702..4791 CDD:299845 12/91 (13%)
COG4372 4996..>5260 CDD:226809 54/293 (18%)
I-set 6536..6622 CDD:254352 32/138 (23%)
Ig 6554..6622 CDD:143165 23/69 (33%)
Ig 6654..6725 CDD:143165 14/85 (16%)
I-set 6743..6829 CDD:254352 24/91 (26%)
Ig 6760..6829 CDD:299845 18/74 (24%)
I-set 6841..6928 CDD:254352 24/87 (28%)
Ig 6858..6927 CDD:143165 21/69 (30%)
I-set 6942..7033 CDD:254352 23/92 (25%)
IGc2 6957..7023 CDD:197706 15/67 (22%)
I-set 7066..7157 CDD:254352 23/97 (24%)
Ig 7084..7153 CDD:143165 19/75 (25%)
IGc2 7224..7289 CDD:197706 14/84 (17%)
Ehrlichia_rpt 14571..15030 CDD:118064 100/597 (17%)
SH3_p47phox_like 16753..16807 CDD:212790 12/97 (12%)
I-set 16841..16931 CDD:254352 24/96 (25%)
Ig 16858..16931 CDD:299845 20/74 (27%)
I-set 16965..17060 CDD:254352 29/166 (17%)
IGc2 16978..17050 CDD:197706 22/142 (15%)
I-set 17068..17152 CDD:254352 20/90 (22%)
Ig_2 17078..17152 CDD:290606 19/80 (24%)
IG_like 17170..17253 CDD:214653 22/136 (16%)
Ig 17180..17250 CDD:143165 19/123 (15%)
I-set 17260..17342 CDD:254352 25/140 (18%)
IGc2 17274..17331 CDD:197706 17/115 (15%)
I-set 17347..17432 CDD:254352 23/110 (21%)
IGc2 17367..17423 CDD:197706 14/62 (23%)
I-set 17437..17521 CDD:254352 20/122 (16%)
Ig <17468..17521 CDD:299845 15/77 (19%)
I-set 17528..17611 CDD:254352 22/144 (15%)
Ig 17553..17602 CDD:143165 14/84 (17%)
I-set 17618..17708 CDD:254352 23/91 (25%)
Ig 17635..17708 CDD:299845 20/73 (27%)
FN3 17712..17791 CDD:238020 25/80 (31%)
I-set 17813..17898 CDD:254352 23/111 (21%)
Ig 17830..17894 CDD:143165 20/90 (22%)
Ig 17922..17994 CDD:299845 20/72 (28%)
FN3 17998..18090 CDD:238020 29/93 (31%)
FN3 18098..18189 CDD:238020 30/91 (33%)
FN3 18207..18298 CDD:238020 32/92 (35%)
FN3 18307..18398 CDD:238020 32/91 (35%)
ttn.1XP_021334746.1 Ig 13385..13457 CDD:325142 15/74 (20%)
FN3 13461..13545 CDD:238020 14/84 (17%)
FN3 13561..13693 CDD:238020 34/149 (23%)
Ig 13717..13790 CDD:325142 11/73 (15%)
FN3 13794..13884 CDD:238020 24/119 (20%)
FN3 13894..13987 CDD:238020 17/93 (18%)
FN3 13993..14086 CDD:238020 18/97 (19%)
I-set 14109..14187 CDD:333254 15/82 (18%)
FN3 14191..14284 CDD:238020 19/98 (19%)
FN3 14292..14383 CDD:238020 18/91 (20%)
FN3 14393..14481 CDD:238020 16/88 (18%)
Ig 14514..14587 CDD:325142 10/73 (14%)
FN3 14591..14682 CDD:238020 13/91 (14%)
FN3 14688..14769 CDD:238020 15/84 (18%)
Ig_Titin_like 14803..14877 CDD:319305 15/82 (18%)
FN3 14881..14965 CDD:238020 20/97 (21%)
FN3 14981..15071 CDD:238020 16/90 (18%)
FN3 15080..15169 CDD:238020 15/90 (17%)
Ig_Titin_like 15207..15274 CDD:319305 12/67 (18%)
FN3 15278..15369 CDD:238020 20/106 (19%)
FN3 15377..15466 CDD:238020 28/140 (20%)
FN3 15478..15570 CDD:238020 14/103 (14%)
Ig_Titin_like 15598..15669 CDD:319305 13/77 (17%)
FN3 15673..15760 CDD:238020 20/117 (17%)
FN3 15770..15860 CDD:238020 26/110 (24%)
Ig_Titin_like 15887..15960 CDD:319305 16/83 (19%)
FN3 15964..16056 CDD:238020 15/92 (16%)
FN3 16064..16154 CDD:238020 21/104 (20%)
FN3 16163..16258 CDD:238020 25/108 (23%)
Ig 16284..16356 CDD:325142 18/100 (18%)
FN3 16360..16452 CDD:238020 22/104 (21%)
FN3 16460..16552 CDD:238020 14/95 (15%)
I-set 6..95 CDD:254352
I-set 104..193 CDD:254352
DNA_pol3_delta2 <235..>332 CDD:331068
I-set 393..482 CDD:254352
I-set 537..626 CDD:254352 30/89 (34%)
I-set 739..829 CDD:333254 28/90 (31%)
I-set 882..972 CDD:254352 34/90 (38%)
I-set 981..1072 CDD:333254 32/91 (35%)
I-set 1128..1219 CDD:254352 39/91 (43%)
I-set 1266..1354 CDD:254352 27/117 (23%)
I-set 1506..1596 CDD:254352 27/92 (29%)
I-set 1604..1677 CDD:333254 22/112 (20%)
I-set 1696..1778 CDD:333254 11/83 (13%)
I-set 1787..1857 CDD:333254 18/81 (22%)
I-set 1875..1958 CDD:333254 28/94 (30%)
I-set 1963..2045 CDD:333254 20/157 (13%)
I-set 2052..2132 CDD:333254 27/103 (26%)
I-set 2136..2220 CDD:333254 23/116 (20%)
I-set 2224..2307 CDD:333254 18/129 (14%)
I-set 2311..2394 CDD:333254 27/123 (22%)
I-set 2399..2481 CDD:333254 27/125 (22%)
I-set 2487..2570 CDD:333254 26/127 (20%)
I-set 2583..2661 CDD:333254 26/109 (24%)
I-set 2667..2756 CDD:254352 26/98 (27%)
I-set 2773..2861 CDD:254352 27/92 (29%)
I-set 2926..3015 CDD:254352 27/104 (26%)
I-set <3114..3178 CDD:333254 16/64 (25%)
I-set 3199..3288 CDD:254352 28/92 (30%)
I-set 3295..3383 CDD:333254 21/91 (23%)
I-set 3390..3477 CDD:333254 32/137 (23%)
I-set 3485..3572 CDD:333254 30/226 (13%)
I-set 3580..3668 CDD:333254 26/121 (21%)
I-set 3675..3763 CDD:254352 27/99 (27%)
I-set 3770..3858 CDD:333254 26/209 (12%)
I-set 3867..3955 CDD:254352 27/154 (18%)
I-set 3964..4053 CDD:254352 25/89 (28%)
I-set 4082..4170 CDD:254352 30/95 (32%)
I-set 4275..4343 CDD:333254 21/94 (22%)
I-set 4372..4458 CDD:254352 19/110 (17%)
Neuromodulin_N <4484..5173 CDD:331332 204/850 (24%)
Neuromodulin_N <4932..5698 CDD:331332 203/825 (25%)
MIP-T3 5601..>5845 CDD:313469 63/296 (21%)
I-set 5875..5966 CDD:254352 23/93 (25%)
IG_like 5979..6056 CDD:214653 18/104 (17%)
I-set 6065..6155 CDD:333254 26/107 (24%)
I-set 6154..6233 CDD:333254 26/90 (29%)
I-set 6243..6327 CDD:333254 25/97 (26%)
I-set 6333..6415 CDD:333254 26/122 (21%)
I-set 6422..6503 CDD:333254 20/132 (15%)
I-set 6509..6592 CDD:333254 14/88 (16%)
I-set 6598..6673 CDD:333254 15/75 (20%)
I-set 6687..6770 CDD:333254 20/102 (20%)
I-set 6775..6859 CDD:333254 22/118 (19%)
I-set 6865..6948 CDD:333254 21/99 (21%)
I-set 6956..7037 CDD:333254 16/94 (17%)
I-set 7043..7126 CDD:333254 21/137 (15%)
I-set 7132..7204 CDD:333254 21/90 (23%)
I-set 7221..7292 CDD:333254 20/94 (21%)
I-set 7310..7393 CDD:333254 20/86 (23%)
I-set 7398..7486 CDD:333254 19/90 (21%)
I-set 7492..7575 CDD:254352 18/83 (22%)
I-set 7582..7651 CDD:333254 16/74 (22%)
I-set 7670..7743 CDD:333254 6/73 (8%)
Ig 7773..7843 CDD:325142 11/70 (16%)
FN3 7847..7938 CDD:238020 23/129 (18%)
FN3 7947..8036 CDD:238020 15/89 (17%)
FN3 8048..8137 CDD:238020 13/89 (15%)
Ig 8170..8240 CDD:325142 24/125 (19%)
FN3 8244..8329 CDD:238020 16/105 (15%)
FN3 8344..8428 CDD:238020 20/103 (19%)
Ig 8463..8536 CDD:325142 19/96 (20%)
FN3 8540..8631 CDD:238020 18/91 (20%)
FN3 8639..8728 CDD:238020 6/89 (7%)
FN3 8740..8828 CDD:238020 22/99 (22%)
FN3 8840..8926 CDD:238020 18/90 (20%)
FN3 8940..9033 CDD:238020 13/93 (14%)
FN3 9041..9134 CDD:238020 20/93 (22%)
I-set 9143..9232 CDD:333254 18/90 (20%)
FN3 9236..9322 CDD:238020 13/86 (15%)
FN3 9336..9428 CDD:238020 17/93 (18%)
Ig 9457..9559 CDD:325142 19/115 (17%)
FN3 9563..9654 CDD:238020 19/95 (20%)
FN3 9664..9752 CDD:238020 14/94 (15%)
FN3 9770..9855 CDD:238020 13/85 (15%)
Ig 9882..9954 CDD:325142 14/72 (19%)
FN3 9958..10047 CDD:238020 8/89 (9%)
FN3 10056..10147 CDD:238020 22/125 (18%)
Ig 10176..10255 CDD:325142 15/79 (19%)
FN3 10259..10352 CDD:238020 15/98 (15%)
FN3 10360..10457 CDD:238020 12/97 (12%)
FN3 10466..10558 CDD:238020 24/100 (24%)
Ig 10588..10669 CDD:325142 20/97 (21%)
FN3 10673..10764 CDD:238020 18/104 (17%)
FN3 10773..10866 CDD:238020 19/93 (20%)
I-set 10880..10974 CDD:333254 21/123 (17%)
FN3 10978..11068 CDD:238020 16/96 (17%)
FN3 11078..11174 CDD:238020 19/97 (20%)
FN3 11189..11269 CDD:238020 17/81 (21%)
Ig 11302..11373 CDD:325142 16/71 (23%)
FN3 11377..11462 CDD:238020 8/85 (9%)
FN3 11478..11571 CDD:238020 24/94 (26%)
Ig 11603..11669 CDD:325142 12/66 (18%)
FN3 11673..11765 CDD:238020 21/97 (22%)
FN3 11773..11862 CDD:238020 21/108 (19%)
FN3 11874..11966 CDD:238020 33/114 (29%)
Ig_Titin_like 11996..12065 CDD:319305 12/69 (17%)
FN3 12071..12158 CDD:238020 17/101 (17%)
FN3 12171..12261 CDD:238020 24/116 (21%)
Ig 12288..12361 CDD:325142 23/121 (19%)
FN3 12365..12450 CDD:214495 19/111 (17%)
FN3 12467..12555 CDD:238020 19/96 (20%)
FN3 12567..12659 CDD:238020 21/98 (21%)
Ig 12688..12760 CDD:325142 15/72 (21%)
FN3 12764..12852 CDD:238020 12/92 (13%)
FN3 12863..12954 CDD:238020 28/107 (26%)
Ig_Titin_like 12980..13055 CDD:319305 11/78 (14%)
FN3 13059..13150 CDD:238020 16/100 (16%)
FN3 13158..13251 CDD:238020 21/96 (22%)
FN3 13259..13358 CDD:238020 18/101 (18%)
FN3 16561..16651 CDD:238020 19/100 (19%)
Ig_Titin_like 16684..16755 CDD:319305 14/84 (17%)
FN3 16759..16848 CDD:238020 13/89 (15%)
FN3 16856..16939 CDD:238020 19/95 (20%)
Ig 16971..17044 CDD:325142 13/84 (15%)
FN3 17048..17140 CDD:238020 25/118 (21%)
FN3 17148..17238 CDD:238020 11/95 (12%)
FN3 17247..17336 CDD:238020 16/89 (18%)
Ig_Titin_like 17367..17440 CDD:319305 14/75 (19%)
FN3 17444..17536 CDD:238020 14/92 (15%)
FN3 17544..17636 CDD:238020 15/96 (16%)
FN3 17645..17752 CDD:238020 19/112 (17%)
Ig_Titin_like 17785..17856 CDD:319305 20/74 (27%)
FN3 17860..17946 CDD:238020 13/94 (14%)
FN3 17960..18040 CDD:238020 16/84 (19%)
Ig_Titin_like 18072..18144 CDD:319305 17/72 (24%)
FN3 18149..18232 CDD:238020 24/102 (24%)
FN3 18249..18332 CDD:238020 14/85 (16%)
FN3 18348..18434 CDD:238020 16/91 (18%)
Ig_Titin_like 18468..18541 CDD:319305 17/75 (23%)
FN3 18545..18637 CDD:238020 14/97 (14%)
FN3 18645..18735 CDD:238020 16/90 (18%)
FN3 18746..18833 CDD:238020 11/87 (13%)
Ig_Titin_like 18867..18938 CDD:319305 20/73 (27%)
FN3 18942..19032 CDD:238020 28/98 (29%)
FN3 19039..19122 CDD:238020 22/103 (21%)
Ig_Titin_like 19154..19227 CDD:319305 20/73 (27%)
FN3 19231..19324 CDD:238020 29/94 (31%)
FN3 19339..19421 CDD:238020 26/83 (31%)
FN3 19430..19523 CDD:238020 3/93 (3%)
Ig 19553..19623 CDD:325142 0/70 (0%)
FN3 19627..19719 CDD:238020 33/93 (35%)
FN3 19727..19811 CDD:238020 31/85 (36%)
FN3 <19848..19916 CDD:238020 6/31 (19%)
Ig_Titin_like 19949..20020 CDD:319305
FN3 20024..20115 CDD:238020
FN3 20121..20204 CDD:238020
Ig_Titin_like 20236..20309 CDD:319305
FN3 20313..20400 CDD:238020
FN3 20412..20504 CDD:238020
FN3 20511..20604 CDD:238020
Ig_Titin_like 20632..20697 CDD:319305
FN3 20715..20801 CDD:238020
FN3 20808..20898 CDD:238020
FN3 20909..21000 CDD:238020
Ig_Titin_like 21028..21099 CDD:319305
FN3 21103..21194 CDD:238020
FN3 21200..21283 CDD:238020
Ig 21318..21391 CDD:325142
FN3 21395..21488 CDD:238020
FN3 21495..21585 CDD:238020
FN3 21594..21680 CDD:238020
Ig 21714..21787 CDD:325142
FN3 21791..21883 CDD:238020
FN3 21891..21983 CDD:238020
FN3 21995..22078 CDD:238020
Ig_Titin_like 22113..22187 CDD:319305
FN3 22191..22280 CDD:238020
FN3 22288..22379 CDD:238020
Ig 22405..22477 CDD:325142
FN3 22482..22574 CDD:238020
FN3 22582..22675 CDD:238020
FN3 22681..22769 CDD:238020
Ig_Titin_like 22800..22872 CDD:319305
FN3 22878..22968 CDD:238020
FN3 22976..23069 CDD:238020
FN3 23078..23162 CDD:238020
Ig 23198..23269 CDD:325142
FN3 23273..23356 CDD:238020
FN3 23370..23453 CDD:238020
Ig_Titin_like 23488..23561 CDD:319305
FN3 23565..23657 CDD:238020
FN3 23665..23754 CDD:238020
FN3 23764..23860 CDD:238020
Ig 23891..23961 CDD:325142
FN3 23965..24047 CDD:238020
FN3 24064..24152 CDD:238020
FN3 24166..24254 CDD:238020
Ig_Titin_like 24286..24357 CDD:319305
FN3 24361..24452 CDD:238020
FN3 24458..24551 CDD:238020
Ig 24578..24651 CDD:325142
FN3 24655..24746 CDD:238020
FN3 24755..24841 CDD:238020
FN3 24856..24949 CDD:238020
Ig_Titin_like 24976..25047 CDD:319305
FN3 25051..25140 CDD:238020
FN3 25159..25237 CDD:238020
FN3 25253..25338 CDD:238020
I-set 25364..25439 CDD:254352
Ig 25465..25531 CDD:325142
FN3 25546..25632 CDD:238020
FN3 25645..25732 CDD:238020
I-set 25748..25839 CDD:254352
Ig_Titin_like 25864..25938 CDD:319305
FN3 25942..26029 CDD:238020
STKc_Titin 26070..26346 CDD:271006
I-set 26393..26478 CDD:254352
I-set 26510..26602 CDD:254352
I-set 26615..26703 CDD:254352
I-set 27166..27255 CDD:254352
Ig_Titin_like 27376..27467 CDD:143224
I-set 27534..27623 CDD:254352
I-set 27665..27743 CDD:333254
I-set 27751..27840 CDD:254352
I-set 27940..28032 CDD:254352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0613
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126738
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.