DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbl and Prkaa2

DIOPT Version :9

Sequence 1:NP_524672.1 Gene:trbl / 43999 FlyBaseID:FBgn0028978 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_076481.1 Gene:Prkaa2 / 78975 RGDID:620893 Length:552 Species:Rattus norvegicus


Alignment Length:295 Identity:83/295 - (28%)
Similarity:134/295 - (45%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 TGEQFLCRIVN-------EPLHKVQRAYFQLQQHDEELRRSTIYGHPLIRPVHDIIPLTKDRTYI 204
            ||.:...:|:|       :.:.|::|          |::...::.||.|..::.:|....| .::
  Rat    38 TGHKVAVKILNRQKIRSLDVVGKIKR----------EIQNLKLFRHPHIIKLYQVISTPTD-FFM 91

  Fly   205 LIAPVPQERDSTGGVTGVYENLHTYIRHAKRLCETEARAIFHQICQTVQVCHRNGIILRDLKLKR 269
            ::..|      :||      .|..||....|:.|.|||.:|.||...|..|||:.::.||||.:.
  Rat    92 VMEYV------SGG------ELFDYICKHGRVEEVEARRLFQQILSAVDYCHRHMVVHRDLKPEN 144

  Fly   270 FYFIDEARTKLQYESLEGSMILDGEDDTLSDKIGCPLYTAPELLCPQQTYKGKPADMWSLGVILY 334
            .....:...|:....| .:|:.|||  .|....|.|.|.|||:: ..:.|.|...|:||.|||||
  Rat   145 VLLDAQMNAKIADFGL-SNMMSDGE--FLRTSCGSPNYAAPEVI-SGRLYAGPEVDIWSCGVILY 205

  Fly   335 TMLVGQYPFYEKANCNLITVIRHGNVQIPLTLSKSVRWLLLSLLRKDYTERMTASHIFLTPWLRE 399
            .:|.|..||.::....|...||.|...||..|::|:..||:.:|:.|..:|.|...|....|.::
  Rat   206 ALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSIATLLMHMLQVDPLKRATIKDIREHEWFKQ 270

  Fly   400 QRPFHMYLPVDVEVAEDWSDAEEDEGTAADAMDDD 434
            ..|.:::              .||....|:.:||:
  Rat   271 DLPSYLF--------------PEDPSYDANVIDDE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trblNP_524672.1 PKc_like 131..397 CDD:328722 76/256 (30%)
Prkaa2NP_076481.1 STKc_AMPK_alpha 13..268 CDD:270981 76/256 (30%)
S_TKc 16..268 CDD:214567 76/256 (30%)
UBA_AID_AAPK2 285..349 CDD:270587 3/7 (43%)
AIS. /evidence=ECO:0000250 291..376 0/1 (0%)
AMPKA2_C 395..550 CDD:213385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 478..520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.