DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pten and Gak

DIOPT Version :10

Sequence 1:NP_477422.2 Gene:Pten / 43991 FlyBaseID:FBgn0026379 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_705797.1 Gene:Gak / 231580 MGIID:2442153 Length:1305 Species:Mus musculus


Alignment Length:114 Identity:24/114 - (21%)
Similarity:39/114 - (34%) Gaps:40/114 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMGGHGR------RRKSSSSFSVVKS------LFARCSKEKDNWNEERMI-------------- 39
            :.:||.||      :...|||.:|.||      ...:..||:.....|:.|              
Mouse   236 VSVGGDGRHYSFEVKWSDSSSSAVTKSHRELEDFLLKLPKEQSPGGFEKGIVKLLSRGDQCESRD 300

  Fly    40 ---NVRPRIMTTDDD---GC-------SWTIAEPCIDRRATAFIAKFHE 75
               |:|.:.::...|   .|       |.....|| ....:|.:|:.|:
Mouse   301 LERNLREKFLSLSQDVLRRCDISRFFLSDASVLPC-SHCTSAPVARIHQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtenNP_477422.2 PTP_PTEN 31..189 CDD:350359 12/72 (17%)
PTEN_C2 196..335 CDD:463081
GakNP_705797.1 STKc_GAK 39..320 CDD:270938 17/83 (20%)
PTP_GAK 398..560 CDD:350412
PTEN_C2 568..706 CDD:463081
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 707..732
PHA03247 <713..1169 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..854
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1037..1139
DnaJ <1253..1298 CDD:99751
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.