DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and YNL115C

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_014284.1 Gene:YNL115C SGDID:S000005059 Length:644 Species:Saccharomyces cerevisiae

Alignment Length:140 Identity:29/141 (21%)
Similarity:45/141 (32%) Gaps:58/141 (41%)


  Fly    35 TTMDW--------LEAQNVSHEV-HNVTTADGYQLQL------------QRLPRLGAKPVLLV-H 77
            ||:|.        :..|:.|:|. |.|..|..|||.:            ..|.....:|::|. |
Yeast   290 TTLDTYRLTHKLPITVQSPSYEAFHYVDAAKTYQLHITCYGDVFDQENNTDLSENKKQPIILFEH 354

  Fly    78 GLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAY 142
            |  |...|::..                .|:..|        .|:|      :..|:..::...|
Yeast   355 G--GYDTGYLSA----------------TWIEEL--------YHLD------KIQRYCLYDRPGY 387

  Fly   143 DL----PAII 148
            .|    ||.|
Yeast   388 GLSDSPPAPI 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 29/141 (21%)
Abhydro_lipase 48..90 CDD:282003 14/56 (25%)
YNL115CNP_014284.1 DUF2417 26..328 CDD:313541 12/38 (32%)
Abhydrolase_1 348..551 CDD:306935 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.