DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and IMO32

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_011545.1 Gene:IMO32 SGDID:S000003263 Length:342 Species:Saccharomyces cerevisiae

Alignment Length:284 Identity:66/285 (23%)
Similarity:112/285 (39%) Gaps:84/285 (29%)


  Fly     4 SGCIGAIKVMLIVCAIGRNAHSSPPESRYKWTTMDWLEAQNVSHEV---HNVTTADGYQLQLQRL 65
            |.||  .|..|  ||.    ||.....:.|...:|      :|:::   ..|.|.|      :..
Yeast    28 SSCI--FKQSL--CAF----HSLAKVLQQKQVPLD------LSYDIIKRDAVKTGD------EGK 72

  Fly    66 PRLGAKPVLLVHGLLGSSLGWVCMGPERSLAFQLHHR-EYDVWLANLR--GVSPYGRQHIDLTDV 127
            ||   .|::::|||.|:.|.      .||:...|:.: ..||:|.:||  |.||:...|  ..:|
Yeast    73 PR---PPIIILHGLFGNKLN------NRSIGRNLNKKLGRDVYLLDLRNHGSSPHSSVH--NYEV 126

  Fly   128 MVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVL 192
            |.|..:....:|                   :|.:.|||           ::||||......::|
Yeast   127 MSEDVKHFITKH-------------------ELNTNGGP-----------IIIGHSMGGKVAMML 161

  Fly   193 CAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKRQKAYKFEIFPPGYFRKVCQAK 257
            ...:|:....:..|:. ||:: |.....|..: ::.||:.:..:.|.          .|.:.||.
Yeast   162 VLKNPQLCSMLVCIEN-APVS-LRPNAEFVEY-IKALMEIVNDKGKT----------IRTLKQAD 213

  Fly   258 RDLCEYYAKQLVGSAQNNKKLLEA 281
                |:.|:::.|:....:.||.|
Yeast   214 ----EHLAERIGGNELVRRFLLTA 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 59/265 (22%)
Abhydro_lipase 48..90 CDD:282003 11/45 (24%)
IMO32NP_011545.1 Abhydrolase_1 75..326 CDD:278959 49/215 (23%)
Abhydrolase_5 76..>168 CDD:289465 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.