DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip2 and AT1G18460

DIOPT Version :9

Sequence 1:NP_524667.1 Gene:Lip2 / 43980 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_173281.1 Gene:AT1G18460 / 838426 AraportID:AT1G18460 Length:701 Species:Arabidopsis thaliana


Alignment Length:411 Identity:117/411 - (28%)
Similarity:184/411 - (44%) Gaps:67/411 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TTMDWLEAQNVSHEVHNVTTADGYQLQLQRLPRLGA-KPVLLVHGLLGSSLGWVCMGPERSLAFQ 98
            |..|.:......:|...|.|:|||.|.|:|:||..| |.|.|.||::.||:|||..|...|.||.
plant   293 TCQDVITELGYPYEAIRVVTSDGYGLLLERIPRRDARKAVYLQHGVMDSSMGWVSNGVVGSPAFA 357

  Fly    99 LHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASR 163
            .:.:.|||:|.|.||:  ..|.|:.......:|||:|.:||...|:||:|:.:.::...|....:
plant   358 AYDQGYDVFLGNFRGL--VSRDHVKKNISSKDFWRYSINEHATEDIPAMIEKIHEIKTSELKLYQ 420

  Fly   164 GGPGQDE---EQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQ---RIQLIQALAPLARLHRQVRFD 222
              |..:|   |...:::.::.||.. .|.:::..:..:..:   |:..:..|:| |..|    :|
plant   421 --PTMEEVVNEDQPYKLCVVSHSLG-GAAVLMYVITRKIEEKPHRLSRLILLSP-AGFH----YD 477

  Fly   223 SFQVRRLMKF--------IKKRQKAYKFEIFPPGYFRKVC-QAKRDLCEYYA---------KQLV 269
            |.....||::        :.:...|:   ..|..:||.:. :..||...|.|         ..:|
plant   478 SNMCFTLMEYTFLFLGPVLSRIVPAF---YIPTKFFRMLLNKLARDFHNYPAVGGLVQTLMSYVV 539

  Fly   270 GSAQNN---KKLLEAFNYEYLLQGGSPREIKHLQQIWKSGDFISYDFGTAE-NLQVYHSVEALS- 329
            |...:|   ...|..:|... :.|.|.|..:||.||..||.|..:|:|::. |:.||.|.|.|. 
plant   540 GGDSSNWVGVMGLPHYNMND-MPGISFRVAQHLAQIKHSGKFKMFDYGSSSANMDVYGSPEPLDL 603

  Fly   330 ---YNISQITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSL 391
               |.:  |.||:.|..|:.|.:..|..|...| |::|........|..::.||||..|      
plant   604 GEFYGL--IDVPVDLVAGKKDKVIRPSMVRKHY-RVMRDSGVDVSYNEFEYAHLDFTFS------ 659

  Fly   392 VNDKLIEHMEQFFDGRLPYVI 412
                   |.|:.    |.||:
plant   660 -------HREEL----LAYVM 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 114/404 (28%)
Abhydro_lipase 48..90 CDD:282003 22/42 (52%)
AT1G18460NP_173281.1 Abhydro_lipase 294..349 CDD:282003 23/54 (43%)
Abhydrolase_1 330..632 CDD:278959 89/317 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H62775
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113381
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.