DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and ABHD8

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_078803.4 Gene:ABHD8 HGNCID:23759 Length:439 Species:Homo sapiens

Alignment Length:318 Identity:64/319 (20%)
Similarity:104/319 (33%) Gaps:98/319 (31%)


  Fly    42 AQNVSHEVH-----NVTTADGYQLQLQRLPRLGAKPVLLVHGLLGSSLGWVCMGPERSLAFQLHH 101
            |:.....:|     .:|:..|.|..:         .:..:||:.||...|     :..|.|.: .
Human   151 ARRPKRTIHIDCEKRITSCKGAQADV---------VLFFIHGVGGSLAIW-----KEQLDFFV-R 200

  Fly   102 REYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGP 166
            ..|:|...:|.|   :|............|:..      |.|:.||....||             
Human   201 LGYEVVAPDLAG---HGASSAPQVAAAYTFYAL------AEDMRAIFKRYAK------------- 243

  Fly   167 GQDEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDS-FQVRRLM 230
                    .:.||||||...:....|...:|....::.:|....|.|   .:..|.| |.:...:
Human   244 --------KRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTA---LEPSFCSIFNMPTCV 297

  Fly   231 KFIKKRQKAYKFEIFPPGYFRKVCQAKRDLCEYYAKQLVGSAQNNKKLLEAFNYEYLLQGGSPRE 295
            ........|:.|  ...|:.|:..:.|:.|.|       |:|.|    :.:|....::.|     
Human   298 LHCLSPCLAWSF--LKAGFARQGAKEKQLLKE-------GNAFN----VSSFVLRAMMSG----- 344

  Fly   296 IKHLQQIWKSGDFISYDFGTAENLQVYHSVEALSYNISQITVPIILYFGETDAIATPE 353
                 |.|..||            :|||         :::|||::|..|..|.....|
Human   345 -----QYWPEGD------------EVYH---------AELTVPVLLVHGMHDKFVPVE 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 64/319 (20%)
Abhydro_lipase 48..90 CDD:282003 9/47 (19%)
ABHD8NP_078803.4 MhpC 156..416 CDD:223669 63/314 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.