DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and Lipm

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_076392.1 Gene:Lipm MGIID:1926003 Length:422 Species:Mus musculus

Alignment Length:434 Identity:113/435 (26%)
Similarity:192/435 (44%) Gaps:75/435 (17%)


  Fly    12 VMLIVCAIGRNAHS-------SPPESRYKWTTMDWLEAQNVSH---------EVHNVTTADGYQL 60
            ::|:...:.||.:|       :.||:           ..|||.         |.:.|.|.|||.|
Mouse    20 LILVAYLLQRNVNSGHLPTKAADPEA-----------FMNVSEIIKHKGYPSEEYEVATEDGYIL 73

  Fly    61 QLQRLPR-------LGAKP-VLLVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPY 117
            .:.|:||       .|::| |||.|||||.:..|:...|..||.|.|....:|||:.|.|| :.:
Mouse    74 SVNRIPRGQTRLKKEGSRPVVLLQHGLLGDASNWISNLPNNSLGFILADAGFDVWMGNSRG-NTW 137

  Fly   118 GRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGH 182
            .|:|..|:....|||.||:.|...:||||:|:.:.:.||                 ..:|..:|:
Mouse   138 SRKHKTLSIDQDEFWAFSYDEMARFDLPAVINFILQKTG-----------------QKKVYYVGY 185

  Fly   183 SQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRL----MKFIKKRQKAYKFE 243
            ||......:..:..|....:|::..||||:|.: :..|....:...|    :|.:..||:.    
Mouse   186 SQGTTMGFIAFSTMPELAHKIKMYFALAPIATV-KYARSPGTKFLLLPDMMIKVLFGRQEF---- 245

  Fly   244 IFPPGYFRK----VC-QAKRD-LCEYYAKQLVGSAQNNKKLLEAFNY-EYLLQGGSPREIKHLQQ 301
            ::...:||:    :| |...| :|......|.|...||..:..|..| .:...|.|.:.|.|..|
Mouse   246 LYQTRFFRQLFIYLCGQMILDQICSNIILLLGGFNTNNMNMSRANVYVAHTPAGTSVQNILHWSQ 310

  Fly   302 IWKSGDFISYDFGT-AENLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYARMLRS 365
            ...||:..::|:|: .:|.:..:....:.|.:..:.||..::.|..|.::.|:.|..:.:.:   
Mouse   311 AVNSGELRAFDWGSETKNQEKCNQPTPIRYKVRDMMVPTAMWTGGQDWLSNPDDVKTLLSEV--- 372

  Fly   366 VKSVRRINSKKFNHLDFLISGDVKSLVNDKLIEHMEQFFDGRLP 409
            ...:...|..::.|:||:...|....|.:::|..|:|  :..||
Mouse   373 TNLIYHKNIPEWAHVDFIWGLDAPQRVYNEIIHLMKQ--EPNLP 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 108/419 (26%)
Abhydro_lipase 48..90 CDD:282003 21/50 (42%)
LipmNP_076392.1 Abhydro_lipase 49..111 CDD:282003 23/62 (37%)
Abhydrolase_1 92..392 CDD:278959 86/326 (26%)
Abhydrolase_5 93..>220 CDD:289465 47/146 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93926149
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11005
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.