DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and Abhd11

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_660250.1 Gene:Abhd11 MGIID:1916008 Length:307 Species:Mus musculus

Alignment Length:145 Identity:30/146 (21%)
Similarity:51/146 (35%) Gaps:49/146 (34%)


  Fly    73 VLLVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFH 137
            ::.:|||.||...:      .|||..:..|.              ||:.:.:          ...
Mouse    61 IVFLHGLFGSKTNF------NSLAKAMVQRT--------------GRRVLTV----------DAR 95

  Fly   138 EHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQV-----VLIGHSQAFNAFLVLCAVHP 197
            .||  |.|...|           ||.....||.:.:..|:     ||:|||......::|....|
Mouse    96 NHG--DSPHSPD-----------ASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRP 147

  Fly   198 RFNQRIQLIQALAPL 212
            ...:|:.::. ::|:
Mouse   148 DVVERLVVVD-ISPV 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 30/146 (21%)
Abhydro_lipase 48..90 CDD:282003 5/17 (29%)
Abhd11NP_660250.1 Abhydrolase_5 60..196 CDD:289465 30/146 (21%)
PRK10673 61..307 CDD:182637 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.