DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and LIPK

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011538375.1 Gene:LIPK HGNCID:23444 Length:419 Species:Homo sapiens

Alignment Length:421 Identity:117/422 (28%)
Similarity:189/422 (45%) Gaps:85/422 (20%)


  Fly    20 GRNAHSSPPESRYKWTTMDWLEAQNVS---------HEVHNVTTADGYQLQLQRLP-------RL 68
            |.||:   ||:.           .|:|         :|.::|||.|||.|.:.|:|       |.
Human    44 GNNAN---PEAN-----------MNISQIISYWGYPYEEYDVTTKDGYILGIYRIPHGRGCPGRT 94

  Fly    69 GAKP-VLLVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFW 132
            ..|| |.|.|||:.|:..|:|..|..||||.|....|||||.|.|| :.:.|:|:.|:....|:|
Human    95 APKPAVYLQHGLIASASNWICNLPNNSLAFLLADSGYDVWLGNSRG-NTWSRKHLKLSPKSPEYW 158

  Fly   133 RFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAVHP 197
            .||..|...|||||.|:.:.:.||.::|                 ..:||||......:..:.:|
Human   159 AFSLDEMAKYDLPATINFIIEKTGQKRL-----------------YYVGHSQGTTIAFIAFSTNP 206

  Fly   198 RFNQRIQLIQALAPLARLHRQVRFDSFQV-------RRLMKFIKKRQKAYKFEIFPPGYFRKVCQ 255
            ...::|::..||||:.    .|::....:       ||::|.:...:..:...:|......|||.
Human   207 ELAKKIKIFFALAPVV----TVKYTQSPMKKLTTLSRRVVKVLFGDKMFHPHTLFDQFIATKVCN 267

  Fly   256 AK--RDLCEYYAKQLVG-SAQN-NKKLLEAFNYEYLLQGGSPREIKHLQQIWKSGDFISYDFGTA 316
            .|  |.:|..:...|.| ..|| |...|:.: ..:...|.|.:.:.|..|...||...::|:|.:
Human   268 RKLFRRICSNFLFTLSGFDPQNLNMSRLDVY-LSHNPAGTSVQNMLHWAQAVNSGQLQAFDWGNS 331

  Fly   317 -ENLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGV--------HAIYARMLRSVKSVRRI 372
             :|:..:|.:....|||:::.||..::.|..|.:|.|:.|        :.||.:::         
Human   332 DQNMMHFHQLTPPLYNITKMEVPTAIWNGGQDIVADPKDVENLLPQIANLIYYKLI--------- 387

  Fly   373 NSKKFNHLDFLISGDVKSLVNDKLIEHMEQF 403
              ..:||:||.:..|....:...||..||::
Human   388 --PHYNHVDFYLGEDAPQEIYQDLIILMEEY 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 114/418 (27%)
Abhydro_lipase 48..90 CDD:282003 21/50 (42%)
LIPKXP_011538375.1 PLN02872 31..410 CDD:215470 114/414 (28%)
Abhydro_lipase 55..117 CDD:282003 22/62 (35%)
Abhydrolase_5 99..>246 CDD:289465 53/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94093640
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11005
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.