DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and Lipo4

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001310315.1 Gene:Lipo4 MGIID:3779637 Length:398 Species:Mus musculus

Alignment Length:427 Identity:115/428 (27%)
Similarity:192/428 (45%) Gaps:83/428 (19%)


  Fly    15 IVCAIGRNAHSSPPESRYKWTTMDWLEAQNVSH-----EVHNVTTADGYQLQLQRLPR-----LG 69
            :.|:.|...:   ||:...       .:|.:.|     |.:.|.|.|||.|.:.|:|.     ..
Mouse    17 LFCSFGTKKN---PEAHMN-------VSQIIKHWEYPSEEYEVVTDDGYILPINRIPHGKNNANS 71

  Fly    70 AKPVLLV---HGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEF 131
            :.|.::|   ||||.:...||...|:.||||.|....||||:.:.|| |.:.::|:.|.....||
Mouse    72 SAPKMVVFCQHGLLATPGAWVSNLPDNSLAFILADAGYDVWMGSSRG-STWAKKHVTLNTDSKEF 135

  Fly   132 WRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQ----AFNAFLVL 192
            |.|||.:...|||||.|:.:...||             ::||::    |||||    |..||   
Mouse   136 WDFSFDQMIKYDLPATINFILDKTG-------------QKQIYY----IGHSQGTLIAIGAF--- 180

  Fly   193 CAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKRQKAYKF---EIFPP------G 248
             |.:.:..::|:|...|||:..:..     |..:.||..::........|   |..|.      |
Mouse   181 -ATNQKLAEKIKLNILLAPIYSVQH-----SKGIARLTSYLTPTTIKVLFGEKEFLPTVVSSEVG 239

  Fly   249 YFRKVCQAKRDLCEYYAKQLVGS------AQNNKKLLEAFNYEYLLQGGSPREIKHLQQIWKSGD 307
            .:  ||..  :|.......::||      .|.|...|:.: .:..|.|.|.:.:.|..||.:||.
Mouse   240 AY--VCDI--NLVTAGCAAMIGSMGGYSPEQLNMSRLDVY-VKLNLAGTSVKILIHYNQIRRSGI 299

  Fly   308 FISYDFGTAE-NLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYARM--LRSVKSV 369
            ..:||:|::. |:|.|:......||:..:.||..::.|..|.::.||.|..:..::  |..:|::
Mouse   300 LQAYDWGSSSLNMQHYNQTTPPVYNVEDMKVPTAMFTGLKDFLSDPEDVEILKPKIHNLTYLKTI 364

  Fly   370 RRINSKKFNHLDFLISGDVKSLVNDKLIEHMEQFFDG 406
                 ..|:|.||:...:.:..|:::::..:.: :||
Mouse   365 -----PDFSHFDFIWGLNAREEVSEEILTILRK-YDG 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 113/419 (27%)
Abhydro_lipase 48..90 CDD:282003 17/50 (34%)
Lipo4NP_001310315.1 Abhydro_lipase 33..95 CDD:282003 19/62 (31%)
Abhydrolase_1 77..375 CDD:278959 96/335 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94093257
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11005
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.